Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate 3607129 Dshi_0551 Alcohol dehydrogenase GroES domain protein (RefSeq)
Query= BRENDA::P07913 (341 letters) >FitnessBrowser__Dino:3607129 Length = 347 Score = 130 bits (326), Expect = 6e-35 Identities = 98/326 (30%), Positives = 155/326 (47%), Gaps = 10/326 (3%) Query: 7 LKAEEGIWMTDVPVP-ELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHEY 65 L+A + + D+ +P ELG D+ I I +CG+DVH Y + + PMV+GHE Sbjct: 7 LEAARKLALRDIDLPDELGPEDVRIAIDTVGVCGSDVHYYTHGKIGPFVVKQPMVLGHEA 66 Query: 66 VGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRP--GCFAE 123 G V IG V +GDRV E I G + + G + + P GC Sbjct: 67 AGIVTEIGAAVTHLALGDRVCMEPGIPNGSSKASKLG-VYNVDPAVQFWATPPVHGCLTP 125 Query: 124 YLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAV 182 +V PA FK+PD++S A+ +PF + A + DV LV+GAGPIG+M A Sbjct: 126 SVVHPAAFTFKLPDHVSFAEGAMVEPFAIGMQAAAKARIKPGDVALVTGAGPIGVMVALA 185 Query: 183 AKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMSGA 242 A G V ++D+ E +L +A + + ++N +V+ E G DV E +GA Sbjct: 186 ALAGGCAKVFVSDLVEDKLAIAAGYDNIHPILIPRDNPAEVLQEATEGWGADVVFECAGA 245 Query: 243 PPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMA-AL 301 + + L+ G + +G+P + +D + L ++ ++ + Y A AL Sbjct: 246 AASIQAALEAAAPAGCVVWVGMPVDPVPVDIVLAQSRELRMETVF---RYANMYDRAIAL 302 Query: 302 IQSG-LDLSPIITHRFSIDDFQKGFD 326 + SG +DL P+I+ F +D FD Sbjct: 303 LASGKVDLKPLISATFPFEDSIAAFD 328 Lambda K H 0.322 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 347 Length adjustment: 29 Effective length of query: 312 Effective length of database: 318 Effective search space: 99216 Effective search space used: 99216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory