Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (characterized)
to candidate 3608643 Dshi_2036 Alcohol dehydrogenase GroES domain protein (RefSeq)
Query= SwissProt::Q5SKS4 (343 letters) >FitnessBrowser__Dino:3608643 Length = 327 Score = 132 bits (331), Expect = 2e-35 Identities = 100/336 (29%), Positives = 158/336 (47%), Gaps = 27/336 (8%) Query: 13 LTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARGRIRPPLVTGHEFSGVVEAV 72 L D P P P G+ L+R+++ ICG+D+H + R PL+ GHE +GV+ Sbjct: 12 LAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHD---DRRPAPLILGHEGAGVI--- 65 Query: 73 GPGVRRPQVGDHVSLESHIVCHACPACRTGNYHVCLNTQILGVD-RDGGFAEYVVVPAEN 131 + P+ G+ V++ + C CPAC +G ++C QI+ + RDG FA+YV +PA N Sbjct: 66 ---IGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARN 122 Query: 132 AWVNPKDLPFEVAAILEPFGNAVHTVYAG----SGVSGKSVLITGAGPIGLMAAMVVRAS 187 P D+P E AA+ EP + H V G + S L+ G G IG+ AA+ ++A Sbjct: 123 LVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQ 182 Query: 188 GAGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQ 247 G + + +PN A R Y R N + +V G ++ ++ G +A Sbjct: 183 GVADVTLVEPN----AMRREYLARDAN----YTIATPEQVAGRVFDITVDGVGYDATRAA 234 Query: 248 GLMALIPGGEARILGIPSDPIRFDLAGELVMRGITAFGIAGRRLWQTWMQGTALVYSGRV 307 A PGG +G+ D+ + ++ IT G Q + A ++ GR+ Sbjct: 235 ASAATRPGGLLLHIGLGGGSAGLDIR-RITLQEITVIGTYTYTA-QDFRDTCAAMFDGRL 292 Query: 308 DLSPLLTHRLPLSRYREAFGLLASGQ--AVKVILDP 341 T PLS +AF + +G+ A K+IL P Sbjct: 293 G-GLDWTESRPLSAGADAFADIRAGRVPAPKIILKP 327 Lambda K H 0.321 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 327 Length adjustment: 28 Effective length of query: 315 Effective length of database: 299 Effective search space: 94185 Effective search space used: 94185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory