GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Dinoroseobacter shibae DFL-12

Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate 3609633 Dshi_3016 deoxyribose-phosphate aldolase (RefSeq)

Query= BRENDA::Q9Y315
         (318 letters)



>lcl|FitnessBrowser__Dino:3609633 Dshi_3016 deoxyribose-phosphate
           aldolase (RefSeq)
          Length = 339

 Score =  368 bits (945), Expect = e-106
 Identities = 189/309 (61%), Positives = 235/309 (76%), Gaps = 4/309 (1%)

Query: 5   NRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDT 64
           N G  LDL W+    VN  AV RRA  +  RR+VKK+ QAAWLLKAVT IDLTTL+GDDT
Sbjct: 30  NPGLPLDLDWVRSAAVNTSAVERRAASLPGRRSVKKDHQAAWLLKAVTLIDLTTLAGDDT 89

Query: 65  SSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS 124
           +  ++RLC KA+ P+  ++L AL M    +TT AVCVY   V  AV+AL+ +G  IPVA+
Sbjct: 90  AGRVRRLCAKARQPVAPEVLAALGMGP--VTTGAVCVYHDMVHVAVEALEGSG--IPVAA 145

Query: 125 VAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGE 184
           V+ GFPAG +    R+ EI  +V  GA EID+VI+R  VLTG W+ALYDE+R FR ACG+
Sbjct: 146 VSTGFPAGLSPFHLRVAEIEESVAAGAAEIDIVISRRHVLTGNWQALYDEMRAFRAACGD 205

Query: 185 AHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFF 244
           AH+K ILATGELG L NV +AS++ MMAG+DFIKTSTGKE+VNAT PV++VM+RAIRD+ 
Sbjct: 206 AHVKAILATGELGDLGNVARASLVCMMAGADFIKTSTGKESVNATLPVSLVMIRAIRDYE 265

Query: 245 WKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHH 304
             TG K+G+KPAGGI  AKD+L +LSL+KEELGD WL+P+LFR GAS+LL DIERQ+ HH
Sbjct: 266 AATGVKVGYKPAGGISKAKDALVYLSLIKEELGDRWLQPDLFRFGASSLLGDIERQLEHH 325

Query: 305 VTGRYAAYH 313
           VTG Y+A H
Sbjct: 326 VTGAYSATH 334


Lambda     K      H
   0.320    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 367
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 318
Length of database: 339
Length adjustment: 28
Effective length of query: 290
Effective length of database: 311
Effective search space:    90190
Effective search space used:    90190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate 3609633 Dshi_3016 (deoxyribose-phosphate aldolase (RefSeq))
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.12440.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    1.3e-48  151.3   0.3    2.6e-48  150.3   0.3    1.4  1  lcl|FitnessBrowser__Dino:3609633  Dshi_3016 deoxyribose-phosphate 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3609633  Dshi_3016 deoxyribose-phosphate aldolase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.3   0.3   2.6e-48   2.6e-48       3     203 ..      76     299 ..      74     303 .. 0.94

  Alignments for each domain:
  == domain 1  score: 150.3 bits;  conditional E-value: 2.6e-48
                         TIGR00126   3 akliDhtalkadtteedietlcaeAkky..............kfaavcvnpsyvslAkelLkgteveictv.vgFPl 64 
                                        +liD+t+l  d+t   + +lca+A ++               + avcv+  +v++A+e L+g+ + +++v +gFP+
  lcl|FitnessBrowser__Dino:3609633  76 VTLIDLTTLAGDDTAGRVRRLCAKARQPvapevlaalgmgpvTTGAVCVYHDMVHVAVEALEGSGIPVAAVsTGFPA 152
                                       689**********************998888888878777777889************************978**** PP

                         TIGR00126  65 GasttevkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilEtalLtdeekk.kAsei 140
                                       G s  + +++E +e++++GA E+D+vi  + +  +n+++ +++++a   ac+++++K+il t++L d   + +As +
  lcl|FitnessBrowser__Dino:3609633 153 GLSPFHLRVAEIEESVAAGAAEIDIVISRRHVLTGNWQALYDEMRAFRAACGDAHVKAILATGELGDLGNVaRASLV 229
                                       *******************************************************************87666***** PP

                         TIGR00126 141 sieagadfvKtstgfsakgAtvedvrlmkkvvgd.......evgvKasGGvrtaedalalieagaeriga 203
                                       ++ agadf+Ktstg+  ++At+    +m ++++d       +vg K++GG+  a+dal +++   e +g 
  lcl|FitnessBrowser__Dino:3609633 230 CMMAGADFIKTSTGKESVNATLPVSLVMIRAIRDyeaatgvKVGYKPAGGISKAKDALVYLSLIKEELGD 299
                                       ***********************999**********************************9988888875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (339 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 2.57
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory