Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate 3608624 Dshi_2017 ABC transporter related (RefSeq)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >FitnessBrowser__Dino:3608624 Length = 333 Score = 309 bits (791), Expect = 8e-89 Identities = 171/367 (46%), Positives = 230/367 (62%), Gaps = 36/367 (9%) Query: 1 MATLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGG 60 MATL L NV K++G D + + + + +GEF+++VGPSGCGKSTL+ +AGLET+S G Sbjct: 1 MATLTLDNVKKSFGK--TDVIHGVSIDVTEGEFIVIVGPSGCGKSTLLRMVAGLETVSSG 58 Query: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVS 120 + +D ++ + P DRDIAMVFQ+YALYP MSV DN+A+GLKI K+P AEI + VA + Sbjct: 59 EVRIDGRVVNTLEPMDRDIAMVFQNYALYPHMSVFDNMAYGLKIAKVPKAEIADRVAVAA 118 Query: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 KLLQ+E L RKP +LSGGQ+QRVAMGRA+ R+P ++LFDEPLSNLDAKLRV+MR E+K Sbjct: 119 KLLQLEPYLGRKPKELSGGQRQRVAMGRAIVRKPAVFLFDEPLSNLDAKLRVQMRLEIKA 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPP 240 + + L T++YVTHDQ+EAMTL D++ VM G+ Q G P ++Y NP FVA FIGSPP Sbjct: 179 LQRELGVTSLYVTHDQVEAMTLADRMIVMNGGVADQIGAPLEVYANPQTAFVAGFIGSPP 238 Query: 241 MNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGIRPEQIILANGEANG 300 NF+P + R P G Q +GIRPE + +A Sbjct: 239 TNFLPADMVRAG----------------PAGQQ----------VGIRPEHLRVA-----P 267 Query: 301 LPTIRAEVQVTEPTGPDTLVFVNLND--TKVCCRLAPDVAPAVGETLTLQFDPAKVLLFD 358 + A V E G +TL+ + + T + A PA G T+ L +D + +LF Sbjct: 268 QGRLEAHVAYAEALGAETLLHLRASQGTTLTVRQDAAAPMPAEGATVQLDWDDSDTMLF- 326 Query: 359 AKTGERL 365 A G R+ Sbjct: 327 ADNGRRV 333 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 333 Length adjustment: 29 Effective length of query: 357 Effective length of database: 304 Effective search space: 108528 Effective search space used: 108528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory