Align Kynureninase (EC 3.7.1.3) (characterized)
to candidate 3607822 Dshi_1230 kynureninase (RefSeq)
Query= reanno::WCS417:GFF4622 (416 letters) >FitnessBrowser__Dino:3607822 Length = 393 Score = 385 bits (989), Expect = e-111 Identities = 193/397 (48%), Positives = 265/397 (66%), Gaps = 7/397 (1%) Query: 20 RSQFALPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGLIRSWNNAGWADLSLRLGNR 79 R F LPEGVIYLDGNSLG P A A + EWG LIR WN AGW D RLG+R Sbjct: 4 RDAFDLPEGVIYLDGNSLGPLPRRAEAAVARAMQAEWGAMLIRGWNEAGWMDQPDRLGDR 63 Query: 80 LAPLIGARDNEVAITDTTSINLFKVLSAALTVQRQRQPGRKVIVSEASNFPTDLYIAEGL 139 +APLIGA V + +T SI +F+ L+AAL+++ PGRKVI++EA NFP+DLY+A+GL Sbjct: 64 IAPLIGAAPGTVTVGETLSIRVFQGLAAALSLR----PGRKVILTEAGNFPSDLYMAQGL 119 Query: 140 AELLQQGYSLRLVNSPDELPQAIDQDVAVVMLTHVNYKTGYMYDMQALTALSHECGALSI 199 + L QG+ LR + + E+P A+ +VAV+MLT V+Y++G +DM ALTA +H GAL++ Sbjct: 120 IDALGQGHVLRALPAT-EIPAALTDEVAVLMLTEVDYRSGARHDMAALTAQAHGVGALTL 178 Query: 200 WDLAHSAGAVPIDLHQAGADYAIGCTYKYLNGGPGSQAFVWVNPALVDVVRQPLSGWFGH 259 WDLAHSAGA+P+ L + AD+A GCTYKYLNGGPG+ AF + P ++ R L+GW GH Sbjct: 179 WDLAHSAGALPVALTRCNADFAAGCTYKYLNGGPGAPAFFYARPDHSEITRPILAGWLGH 238 Query: 260 TRQFAMESTYAPSAGIARYLCGTQPITSLAMVECGLEIFAQTDMASLRSKSLALTDLFIA 319 F YAP G AR+ GT P+ +A ++ L+IF D+A+L ++++ L D Sbjct: 239 AAPFDFAPDYAPGPGRARFRIGTPPVLQMAALDAALDIFDGVDIAALHARAIVLADRLAT 298 Query: 320 LVEARCAAHDLKLITPREHAKRGSHVSFEHPEGYAVIQALIARGVIGDYREPRIMRFGFT 379 EA C DL+ +TP + A+RGS ++F HP GYA++QALIA+GVIGD+R P I+RFG T Sbjct: 299 GFEAVCP--DLRRLTPMDPARRGSQIAFAHPNGYAMVQALIAQGVIGDFRAPDILRFGLT 356 Query: 380 PLYTRFTEVWEAVEILGDILDNHTWNQPQFKVRNSVT 416 PLY ++ A+E +++ W+ P ++ RN VT Sbjct: 357 PLYLDAGDIDTAIERFAQVIEGRLWDDPAYRTRNKVT 393 Lambda K H 0.321 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 509 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 393 Length adjustment: 31 Effective length of query: 385 Effective length of database: 362 Effective search space: 139370 Effective search space used: 139370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate 3607822 Dshi_1230 (kynureninase (RefSeq))
to HMM TIGR01814 (kynU: kynureninase (EC 3.7.1.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01814.hmm # target sequence database: /tmp/gapView.12881.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01814 [M=400] Accession: TIGR01814 Description: kynureninase: kynureninase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-80 256.8 0.0 3e-80 256.0 0.0 1.3 1 lcl|FitnessBrowser__Dino:3607822 Dshi_1230 kynureninase (RefSeq) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3607822 Dshi_1230 kynureninase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 256.0 0.0 3e-80 3e-80 14 399 .. 4 376 .. 2 377 .. 0.93 Alignments for each domain: == domain 1 score: 256.0 bits; conditional E-value: 3e-80 TIGR01814 14 RdeFalpkakdeneviyld.NSLalmpkaakealkeeld.kWakllveshevgkapWleldealeklla..lvakek 86 Rd+F lp + viyld NSL+ p++a++a+ +++ +W+++l+++++ +a W++ + +l + a ++a lcl|FitnessBrowser__Dino:3607822 4 RDAFDLP-----EGVIYLDgNSLGPLPRRAEAAVARAMQaEWGAMLIRGWN--EAGWMDQPDRLGDRIAplIGAAPG 73 9******.....99****66**********99998777648**********..***********99888899999** PP TIGR01814 87 evvvmnsltvNlhkllasfykptekRakIlleakaFPsDlyaiesqlklkleveeslvqvepreeetlrledildvi 163 v+v ++l++ +++ la+++ + R++Il+ea +FPsDly+++ + + + lr ++++ lcl|FitnessBrowser__Dino:3607822 74 TVTVGETLSIRVFQGLAAALSLRPGRKVILTEAGNFPSDLYMAQGLIDAL------------GQGHVLRALPATEIP 138 ******************************************87655444............223467777888888 PP TIGR01814 164 ekeqdeiAlvllsgvqYkt.qlfdlaaitkaarkkgalvvfDLaHava.vpleLhdwdvDfAvwCsYKylnaspaag 238 ++ +de+A+ +l++v Y++ d+aa+t++a+ gal +DLaH+++ +p+ L ++DfA C+YKyln +p a lcl|FitnessBrowser__Dino:3607822 139 AALTDEVAVLMLTEVDYRSgARHDMAALTAQAHGVGALTLWDLAHSAGaLPVALTRCNADFAAGCTYKYLNGGPGAP 215 8999***************8899************************99*************************888 PP TIGR01814 239 afvhekkakee..lprlalwwwhekskrfkmeeklelrpaafrlsnppvlsvaalka.LelfdqaslealRkkSllL 312 af ++++ ++e +p la+w +h+ ++ f+ ++ + +a fr+ +ppvl++aal a L++fd ++++al ++ ++L lcl|FitnessBrowser__Dino:3607822 216 AFFYARPDHSEitRPILAGWLGHAAPFDFAPDYAPGPGRARFRIGTPPVLQMAALDAaLDIFDGVDIAALHARAIVL 292 99998887776337889****************999999************************************** PP TIGR01814 313 TdyleeLvkarlayklvleiitPedtaer.sqlslkfskedkavlkalkkrdvviDkRePnviRlaPvpLYntfkDv 388 d l +a + l+ +tP d a+r sq+ ++++ + +a+++al++++v+ D+R+P+++R+ +pLY D+ lcl|FitnessBrowser__Dino:3607822 293 ADRLATGFEAVCPD---LRRLTPMDPARRgSQIAFAHP-NGYAMVQALIAQGVIGDFRAPDILRFGLTPLYLDAGDI 365 *************7...9********************.9************************************* PP TIGR01814 389 ykavevleeil 399 +a+e + +++ lcl|FitnessBrowser__Dino:3607822 366 DTAIERFAQVI 376 *****998886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (400 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.05 # Mc/sec: 3.12 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory