Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate 3607725 Dshi_1134 3-oxoacid CoA-transferase, B subunit (RefSeq)
Query= BRENDA::P0A102 (213 letters) >FitnessBrowser__Dino:3607725 Length = 208 Score = 194 bits (492), Expect = 1e-54 Identities = 103/205 (50%), Positives = 134/205 (65%), Gaps = 2/205 (0%) Query: 9 RTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGDK-EVFLHSENGLLGMGPSPAPGEEDD 67 R +MA R A ++Q+G YVNLGIG PTLV+NY+ + V L SENG+LGMGP P E D Sbjct: 5 RNQMAARAAQELQDGMYVNLGIGIPTLVSNYIPEGITVTLQSENGMLGMGPFPTEDEVDA 64 Query: 68 DLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEGSI 127 DLINAGKQ +T L A+F A SF M+RGG + +A+LGA +V+ GDLANW + I Sbjct: 65 DLINAGKQTITELPQTAYFDSAQSFGMIRGGKIAMAILGAMEVAENGDLANWMIPGK-LI 123 Query: 128 PAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVTPE 187 +GGAMDL G +V V+MDH K GE+KL+ ECT PLTG V + T+L VLEV Sbjct: 124 KGMGGAMDLVAGVGRVIVVMDHTNKRGETKLLKECTLPLTGKGVVDLVITNLGVLEVVEG 183 Query: 188 GLKVVEICADIDFDELQKLSGVPLI 212 GLK+VE + DE++ + ++ Sbjct: 184 GLKIVECAEGVTEDEIRAATEATIV 208 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 208 Length adjustment: 21 Effective length of query: 192 Effective length of database: 187 Effective search space: 35904 Effective search space used: 35904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory