Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate 3608767 Dshi_2159 Transketolase central region (RefSeq)
Query= metacyc::MONOMER-11684 (327 letters) >FitnessBrowser__Dino:3608767 Length = 451 Score = 273 bits (698), Expect = 6e-78 Identities = 144/325 (44%), Positives = 206/325 (63%), Gaps = 3/325 (0%) Query: 1 MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE 60 M M+ +A+ AM EEM R+ VF++GE+V G +K + GL ++FG +RV+DTP+ E Sbjct: 126 MKSMTVREALRDAMAEEMRRNENVFLMGEEVAEYQGAYKISQGLLDEFGSKRVIDTPITE 185 Query: 61 SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG 120 AG+ +GAA G+ PI E +F M A++QII+ AAK Y S CPIV R P G Sbjct: 186 HGFAGLAVGAAFGGLNPIVEFMTFNFAMQAIDQIINSAAKTLYMSGGQMGCPIVFRGPNG 245 Query: 121 GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI 180 A HSQ A +A+ PGLK+ MP + DAKGLLK+A+RD +PV+F E++ Y Sbjct: 246 AAARVAAQHSQDSAAWYAHIPGLKVAMPYSASDAKGLLKSAIRDPNPVIFLENEILYGR- 304 Query: 181 KGEVP-ADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTV 239 EVP DDY +P GKA + REG D+T++++G+ + +AL+AA+RL KDGISA VVDLRT+ Sbjct: 305 SFEVPMIDDYTVPFGKARIWREGRDVTIVSFGIGMTYALEAADRLAKDGISAEVVDLRTL 364 Query: 240 YPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPA 299 PLD E +I + KT + + V E SI + ++A++ + LDAP+ L G D+P Sbjct: 365 RPLDTETVIASVQKTNRCVTVEEGFPVASIGNHISAVLMQEAFDYLDAPVINLTGKDVP- 423 Query: 300 MPYAPTMEKYFMVNPDKVEAAMREL 324 MPYA +EK +V D+V A+ ++ Sbjct: 424 MPYAANLEKLALVTTDEVIEAVHKV 448 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 451 Length adjustment: 30 Effective length of query: 297 Effective length of database: 421 Effective search space: 125037 Effective search space used: 125037 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory