GapMind for catabolism of small carbon sources

 

Aligments for a candidate for epi in Dinoroseobacter shibae DFL-12

Align Ethylmalonyl-CoA/methylmalonyl-CoA epimerase; EC 5.1.99.-; EC 5.1.99.1 (characterized)
to candidate 3609244 Dshi_2630 Methylmalonyl-CoA epimerase (RefSeq)

Query= SwissProt::Q3IZP4
         (134 letters)



>lcl|FitnessBrowser__Dino:3609244 Dshi_2630 Methylmalonyl-CoA
           epimerase (RefSeq)
          Length = 134

 Score =  250 bits (638), Expect = 6e-72
 Identities = 121/134 (90%), Positives = 127/134 (94%)

Query: 1   MIGRLNHVAIAVPDLEAAAAQYRNTLGAEVGAPQDEPDHGVTVIFITLPNTKIELLHPLG 60
           MIGRLNHVAIAVPDLEAA+AQY NTLGA VGAPQDEPDHGVTV+FI LPNTKIELL+PLG
Sbjct: 1   MIGRLNHVAIAVPDLEAASAQYANTLGANVGAPQDEPDHGVTVVFIELPNTKIELLYPLG 60

Query: 61  EGSPIAGFLEKNPAGGIHHICYEVEDILAARDRLKEAGARVLGSGEPKIGAHGKPVLFLH 120
           E SPIAGFLEKNP+GGIHHICYEVEDILAARD+L  AGARVLG+GEPKIGAHGKPVLFLH
Sbjct: 61  ENSPIAGFLEKNPSGGIHHICYEVEDILAARDKLSAAGARVLGTGEPKIGAHGKPVLFLH 120

Query: 121 PKDFNGCLVELEQV 134
           PKDFNG LVELEQV
Sbjct: 121 PKDFNGTLVELEQV 134


Lambda     K      H
   0.319    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 173
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 134
Length of database: 134
Length adjustment: 15
Effective length of query: 119
Effective length of database: 119
Effective search space:    14161
Effective search space used:    14161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

Align candidate 3609244 Dshi_2630 (Methylmalonyl-CoA epimerase (RefSeq))
to HMM TIGR03081 (mce: methylmalonyl-CoA epimerase (EC 5.1.99.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03081.hmm
# target sequence database:        /tmp/gapView.15977.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03081  [M=129]
Accession:   TIGR03081
Description: metmalonyl_epim: methylmalonyl-CoA epimerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    5.4e-54  168.4   0.0      6e-54  168.2   0.0    1.0  1  lcl|FitnessBrowser__Dino:3609244  Dshi_2630 Methylmalonyl-CoA epim


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3609244  Dshi_2630 Methylmalonyl-CoA epimerase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.2   0.0     6e-54     6e-54       1     129 []       4     133 ..       4     133 .. 0.99

  Alignments for each domain:
  == domain 1  score: 168.2 bits;  conditional E-value: 6e-54
                         TIGR03081   1 kldhvaiavkdleeaaklyrdvlGakvseeeelpeqgvkvvflelgetklellepleedspiakflekkkgeGlhhi 77 
                                       +l+hvaiav+dle+a++ y ++lGa+v   ++ p++gv+vvf+el +tk+ell pl+e+spia+flek++ +G+hhi
  lcl|FitnessBrowser__Dino:3609244   4 RLNHVAIAVPDLEAASAQYANTLGANVGAPQDEPDHGVTVVFIELPNTKIELLYPLGENSPIAGFLEKNPSGGIHHI 80 
                                       79*************************************************************************** PP

                         TIGR03081  78 alevddieaaletlkekgvrllde.epriGahGkkvaFlhPkdtgGvLielee 129
                                       ++ev+di aa ++l  +g r+l+  ep+iGahGk+v FlhPkd +G L+ele+
  lcl|FitnessBrowser__Dino:3609244  81 CYEVEDILAARDKLSAAGARVLGTgEPKIGAHGKPVLFLHPKDFNGTLVELEQ 133
                                       **********************988**************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (129 nodes)
Target sequences:                          1  (134 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 4.32
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory