Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate 3608584 Dshi_1978 inner-membrane translocator (RefSeq)
Query= TCDB::Q8DQH9 (318 letters) >FitnessBrowser__Dino:3608584 Length = 317 Score = 127 bits (320), Expect = 3e-34 Identities = 88/284 (30%), Positives = 143/284 (50%), Gaps = 34/284 (11%) Query: 47 ILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPT-----YGAFFGAMLVGAL-L 100 I +GLNL G +G F+ G F G YA I+G +G +G L+G L + Sbjct: 20 IAVLGLNLHWGNTGLFNGGVVAFFGAGGYATLILGGTPQAAHLGGFGLPYGLALLGGLVI 79 Query: 101 SGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILG--------IP 152 +G +A LVG+ T+RL+ DYLA+AT GV+ + N L GA+G+ G IP Sbjct: 80 AGLLAWLVGLLTIRLRHDYLAIATFGVAVAFENLVRNAQRLAGGASGLRGFERPLADTIP 139 Query: 153 NFTTWQMVYF-FVVITTIATL----NFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIA 207 + +F FV+ IAT +R P GR ++REDE AA ++G + +I++ A Sbjct: 140 PGLAYNAAFFAFVLAALIATYLGLERLIRGPFGRLLRAIREDETAARALGKSPDRIRLTA 199 Query: 208 FVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVL--- 264 FV G++ +AG+L A F + P+D I + + +++ GG G+ GAI A ++ Sbjct: 200 FVIGSVILGLAGALYATFYAFISPQDVLPILTFQIWAMLIVGGAGNNRGAIAGAFLIWGA 259 Query: 265 -----------GILNMLLQDVASVRMIIYALALVLVMIFRPGGL 297 + + L S++ ++ +V ++++RP GL Sbjct: 260 WTASGWALSRFAPIEVQLY-TGSIQFVLIGCVIVGMLLWRPQGL 302 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 317 Length adjustment: 27 Effective length of query: 291 Effective length of database: 290 Effective search space: 84390 Effective search space used: 84390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory