Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate 3609760 Dshi_3143 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__Dino:3609760 Length = 290 Score = 162 bits (409), Expect = 1e-44 Identities = 100/279 (35%), Positives = 153/279 (54%), Gaps = 9/279 (3%) Query: 16 PAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVE-FIGLENY-WTVLTDEVFWQAMGRTF 73 PAV+ + I PL+ A S L + +E +IG ENY W + FW ++ T Sbjct: 13 PAVVVVFATAIWPLIEAARMSFTVGRLNRPGSLEQYIGWENYAWAFFEEPAFWNSVYVTA 72 Query: 74 FLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVVGLLGQVMFNQKF 133 + L L LG+AL+L G V A+ L+LP A + A++G+ + MFN +F Sbjct: 73 LYTVVTVGLTTLLALGLALLLAPGGRLRVS--AQTLLILPFAMSPALIGVSFRFMFNPEF 130 Query: 134 GVVNQLLGG-----ADINWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLTMVPGEVEEA 188 G+ + G AD++W+ DP AFA+++ DVW W PF+ LVL+ GL VP + EA Sbjct: 131 GLFDAFFGVMIPPLADVSWLADPTLAFAVVVMADVWGWIPFLTLVLIGGLASVPRDTIEA 190 Query: 189 ARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPGSSTEFISLM 248 A+++ S W V R V LP L P L V+IL++ +LK FD VF LT GGPG++T+ +S Sbjct: 191 AQVDGASSWRVFRDVTLPQLGPVLAVVIILKSIFSLKTFDQVFMLTNGGPGTATQTLSHY 250 Query: 249 IQRVGFRGFDQGLASAQAIILLIITIVLAQIYIRVFYKE 287 I G + G +++ A +++I I L Y + +++ Sbjct: 251 IYFNGMKYGQIGYSASVAWLMVIPMIFLTYAYAKFVFRK 289 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 290 Length adjustment: 26 Effective length of query: 262 Effective length of database: 264 Effective search space: 69168 Effective search space used: 69168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory