Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate 3607127 Dshi_0549 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= uniprot:D8IPH9 (270 letters) >FitnessBrowser__Dino:3607127 Length = 272 Score = 173 bits (439), Expect = 3e-48 Identities = 89/249 (35%), Positives = 142/249 (57%), Gaps = 1/249 (0%) Query: 15 IVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENYRQVIGSPEVLVGLTNSAVI 74 ++++ V VFP W + S+KT + + P ++F PTL NYR+ + VL L NS +I Sbjct: 15 VLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINSLII 74 Query: 75 VGSAVLLGTFMGVPAAYVIARYHVPGKRDIQFFLLSLRFLPPVAVAIPLIAIWVDLGLYD 134 S L +GVPAA+ +AR+ GK+D+ F+ ++ R + P+ +A+P I +LGL D Sbjct: 75 AISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLGLLD 134 Query: 135 TRFSMIVTYLLTTLSTITWLSIPVFQRMPREIEEAATLDGYGPYAVFWKIALPNCATTLL 194 ++I+ YL L + W+ F+ +P +++EAA L+G + + KI LP + Sbjct: 135 KHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMPGVA 194 Query: 195 GGIIFSFVLVWNELMIALALTSSNSATLPVVASAFTSMGQEVPWGVINASTVLLALPPLI 254 IFSF+ WNELM L LT S + T P +A +F G +P+G I A++ L+ +P LI Sbjct: 195 VSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFME-GYNLPYGKIMATSTLIVIPVLI 253 Query: 255 FVGVLSRLL 263 F + S+ L Sbjct: 254 FALIASKQL 262 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 272 Length adjustment: 25 Effective length of query: 245 Effective length of database: 247 Effective search space: 60515 Effective search space used: 60515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory