GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_12060 in Dinoroseobacter shibae DFL-12

Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate 3609043 Dshi_2432 Monosaccharide-transporting ATPase (RefSeq)

Query= uniprot:A0A1N7UKA9
         (325 letters)



>lcl|FitnessBrowser__Dino:3609043 Dshi_2432
           Monosaccharide-transporting ATPase (RefSeq)
          Length = 327

 Score =  178 bits (452), Expect = 1e-49
 Identities = 105/300 (35%), Positives = 169/300 (56%), Gaps = 8/300 (2%)

Query: 32  ILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFAGLC 91
           +LL  ++A     F+   N   +   TS   +LA+G   VILT+ IDLSV + LA  G+ 
Sbjct: 18  LLLLALIASRFPAFIAPSNLAHVFNDTSPLILLAIGQMIVILTRCIDLSVAANLALTGMV 77

Query: 92  SAMV--ATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMTFIL 149
            +MV  A  G  ++  ++  +  G +LG+ NG +V  L IPP V TLG ++I RG+ F++
Sbjct: 78  VSMVNVAAPGLPIVVILAIAIGLGTLLGMFNGLLVWKLQIPPIVVTLGTMTIFRGIIFLI 137

Query: 150 NDGSPIT--DLPDAYLALGIGKIGPIGVPII--IFAVVALIFWMVLRYTTYGRYVYAVGG 205
           +DG  +   ++  A+ A    ++  +G+P++  I  +  ++F +V+  TT GR  YA GG
Sbjct: 138 SDGKWVNSHEMSPAFKAFPRAEL--LGLPVLSWIAILAVILFTIVMTRTTLGRAFYAAGG 195

Query: 206 NEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDAIAAVVIG 265
           N  +A  +GI V K  F  + +SG LAGL G +  +R   +       +ELD +AA VIG
Sbjct: 196 NPHAATYAGIDVGKTQFWAFTISGALAGLTGYLWVSRFAVSYVDIAGGFELDVVAACVIG 255

Query: 266 GTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVLIDVWRKKKR 325
           G S+ GG G++ G L GAL +G+I N L ++ +S ++Q    G  I+ AV ++    +K+
Sbjct: 256 GVSIMGGVGTVGGALLGALFLGIIKNALPVVDISPFWQLAISGGAIIIAVALNAQANRKK 315


Lambda     K      H
   0.326    0.141    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 252
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 325
Length of database: 327
Length adjustment: 28
Effective length of query: 297
Effective length of database: 299
Effective search space:    88803
Effective search space used:    88803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory