GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_12065 in Dinoroseobacter shibae DFL-12

Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 3609459 Dshi_2843 ABC transporter related (RefSeq)

Query= uniprot:A0A1N7TX47
         (495 letters)



>lcl|FitnessBrowser__Dino:3609459 Dshi_2843 ABC transporter related
           (RefSeq)
          Length = 548

 Score =  236 bits (602), Expect = 2e-66
 Identities = 163/488 (33%), Positives = 251/488 (51%), Gaps = 26/488 (5%)

Query: 7   LQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILLN 66
           ++   ++KA+  V A +D  + +  G++H + G NGAGKST +SIL G  + DAG I + 
Sbjct: 26  IELRGISKAFGPVQANKDISIRVMPGTIHGIIGENGAGKSTLMSILYGFYKADAGEIFIK 85

Query: 67  GAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRR--T 124
           G   +      A+ AGI M+ Q  + +   TV EN+ LG E    G ++       R   
Sbjct: 86  GQKTEIPDSQAAIRAGIGMVFQHFKLVENFTVLENVVLGAE---EGALLRPSLAKARKLL 142

Query: 125 RELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLFK 184
           REL +  E +V   + +  LSV   Q VEI KA      ++I+DEPT  +   EA  LF+
Sbjct: 143 RELSEEYELNVAPDALIEDLSVGHQQRVEILKALYRKADILILDEPTGVLTPAEADHLFR 202

Query: 185 AIRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQE- 243
            +  L A+G  I+ ++H+L E+ +  D  S+ R G    + + AD   + L   +VG++ 
Sbjct: 203 ILEGLKAEGKTIILITHKLREIMETTDTVSVMRRGEMTATVKTADTSPEQLAELMVGRKV 262

Query: 244 LTRIDHKVGRECAANTCLQVDNLSRAGE-----FHDISLQLRQGEILGIYGLMGSGRSEF 298
           L R+D    +  A    L VD+L    +        ISLQ+R GE+LGI G+ G+G+SE 
Sbjct: 263 LLRVDKTPAQPGA--PILTVDDLRVVDDQGVERVKGISLQVRAGEVLGIAGVAGNGQSEL 320

Query: 299 LNCIYGLTVADSGSVTLQGKPMPI----GLPKATINAGMSLVTEDRKDSGLVLTGSILSN 354
           L  + G+  A +G VT+ G+ + +       K     G++ V EDR+  GL++      N
Sbjct: 321 LEVLGGMRPA-TGRVTVSGQQIDLTGKHSNGKTRRAQGIAHVPEDRQAEGLIMDYHAWEN 379

Query: 355 IALS-----AYKRLSSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVL 409
           +A       AY R     L++ R     AE  + R  ++     L   + SGGNQQK+VL
Sbjct: 380 VAFGYHDDPAYNR---GLLMDNRAVRADAEGKIARFDVRPADCWLAAKNFSGGNQQKIVL 436

Query: 410 AKCLSTEPVCLLCDEPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIA 469
           A+ +   P  LL  +PTRG+D GA + I+  +      G A ++VS E  E+L LSDR+A
Sbjct: 437 AREIERNPELLLVGQPTRGVDIGAIEFIHQQIIALRDAGKAILLVSVELEEILSLSDRVA 496

Query: 470 VFKGGRLV 477
           V   GR++
Sbjct: 497 VMFDGRIM 504



 Score = 85.9 bits (211), Expect = 3e-21
 Identities = 61/221 (27%), Positives = 110/221 (49%), Gaps = 8/221 (3%)

Query: 274 DISLQLRQGEILGIYGLMGSGRSEFLNCIYGLTVADSGSVTLQGKPMPIGLPKATINAGM 333
           DIS+++  G I GI G  G+G+S  ++ +YG   AD+G + ++G+   I   +A I AG+
Sbjct: 43  DISIRVMPGTIHGIIGENGAGKSTLMSILYGFYKADAGEIFIKGQKTEIPDSQAAIRAGI 102

Query: 334 SLVTEDRKDSGLVLTGSILSNIALSAYK-RLSSWSLINARKETQLAEDMVKRLQIKTTSL 392
            +V +  K   LV   ++L N+ L A +  L   SL  ARK   L  ++ +  ++     
Sbjct: 103 GMVFQHFK---LVENFTVLENVVLGAEEGALLRPSLAKARK---LLRELSEEYELNVAPD 156

Query: 393 ELPVASMSGGNQQKVVLAKCLSTEPVCLLCDEPTRGIDEGAKQEIYHLLDQFVRGGGAAI 452
            L +  +S G+QQ+V + K L  +   L+ DEPT  +       ++ +L+     G   I
Sbjct: 157 AL-IEDLSVGHQQRVEILKALYRKADILILDEPTGVLTPAEADHLFRILEGLKAEGKTII 215

Query: 453 VVSSEAPELLHLSDRIAVFKGGRLVTISTDTALSQEALLRL 493
           +++ +  E++  +D ++V + G +         S E L  L
Sbjct: 216 LITHKLREIMETTDTVSVMRRGEMTATVKTADTSPEQLAEL 256


Lambda     K      H
   0.319    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 644
Number of extensions: 26
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 495
Length of database: 548
Length adjustment: 35
Effective length of query: 460
Effective length of database: 513
Effective search space:   235980
Effective search space used:   235980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory