Align Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH; EC 4.1.2.28 (characterized)
to candidate 3606718 Dshi_0149 dihydrodipicolinate synthase (RefSeq)
Query= SwissProt::P39359 (301 letters) >FitnessBrowser__Dino:3606718 Length = 291 Score = 140 bits (354), Expect = 3e-38 Identities = 95/296 (32%), Positives = 146/296 (49%), Gaps = 7/296 (2%) Query: 4 FSGIIPPVSSTFHRDGTLDKKAMREVADFLINKGVDGLFYLGTGGEFSQMNTAQRMALAE 63 F G +P + + +DG +D + + ++ I +G GL +GT GE ++ + A+ Sbjct: 2 FKGSMPALVTPM-KDGAVDFATLEALVEWQIAEGSHGLVPVGTTGESPTLSHEEHEAVVA 60 Query: 64 EAVTIVDGRVPVLIGVGSPSTDEAVKLAQHAQAYGADGIVAINPYYWKVAPRNLDDYYQQ 123 + + + GRVPV+ G GS +T EAV+ +HA+ GADG + + PYY K + +Y Sbjct: 61 KVIEVAAGRVPVIAGAGSNNTVEAVRFVRHAKDAGADGALVVTPYYNKPTQGGMIAHYTA 120 Query: 124 IARSVTLPVILYNFPDLTGQDLTPETVTRLALQNENIVGIKDTIDSVGHLRTMINTVKSV 183 +A + +P+++YN P + D+TP T+ LA IVG+K D+ G L + T + Sbjct: 121 LAEAADIPIVIYNIPGRSVVDMTPATMAALAAL-PTIVGVK---DATGDLARVSQTRMAC 176 Query: 184 RPSFSVFCGYDDHLLNTMLLGGDGAITASANFAPELSVGIYRAWREGDLATAATLNKKLL 243 P F G D L GG G I+ +AN AP L A GD ATA L KL+ Sbjct: 177 GPEFIQLSGEDATALGFNAHGGVGCISVTANVAPALCAQFQEATLAGDFATALALQDKLM 236 Query: 244 QLPAIYALETPFVSLIKYSMQCVGLPVETYCLPPILEASEEAKDKVHVLLTAQGIL 299 L +E V KY++ +G E L P+L S+ K + + GIL Sbjct: 237 PLHEAIFVEPGLVG-AKYALSLLGKCSEDVRL-PLLGLSDGTKVLIKDAMIHAGIL 290 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 291 Length adjustment: 26 Effective length of query: 275 Effective length of database: 265 Effective search space: 72875 Effective search space used: 72875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory