Align Glyceraldehyde dehydrogenase medium chain; Glyceraldehyde dehydrogenase subunit B; Glyceraldehyde dehydrogenase subunit beta; EC 1.2.99.8 (characterized)
to candidate 3607802 Dshi_1210 molybdopterin dehydrogenase FAD-binding (RefSeq)
Query= SwissProt::Q4J6M6 (281 letters) >FitnessBrowser__Dino:3607802 Length = 284 Score = 174 bits (440), Expect = 3e-48 Identities = 98/278 (35%), Positives = 153/278 (55%), Gaps = 4/278 (1%) Query: 1 MYPPEFSYVRAESLQEALKFL-EGNDNTRPLAGGQSLIPMLKLRVLSPDYILDINRLNEL 59 M PP F Y R L A+ L E D R LAGG SLIPM+KLR+ + ++++D+ + EL Sbjct: 1 MIPPAFEYHRPTDLASAVSVLQEHGDEARCLAGGHSLIPMMKLRMAAVEHLVDLQDIAEL 60 Query: 60 NYVKTSLNGVSIGALTRYHDILSNDIVKSKVPLMHHATRTIGDMQVRNMGTIGGAISNAD 119 ++ V++GA+ H ++++D + S PL+ A I D QVR MGT+GG ++N D Sbjct: 61 REIRVEGGRVTLGAMVTQHALITSDALASAAPLLREAAEQIADPQVRYMGTVGGNVANGD 120 Query: 120 PASDMPVVLTALNATIILSSASGSRSVKALDFFKGPFTTDTNKGELVTQIEVPV-LDGYK 178 P +DMP ++ AL+A+ L G+R V A DFF+G +TT E++TQI GY Sbjct: 121 PGNDMPGLMQALDASFTLMGPDGTREVAARDFFEGAYTTTREDEEILTQIAFDAHAKGY- 179 Query: 179 TVYKKVVRRAGDYALASVALAIKLKGNEIEDIKLAYGGVHDKPFRAMEVEKNVIGKKLND 238 Y+K R+ GDYA A+ A+ I+ G + +A + D P + ++G + Sbjct: 180 -AYEKQKRKIGDYATAAAAVLIEKDGTVAGKVDIAMTNLSDTPVYSAAAGAALVGTSCDA 238 Query: 239 DLVKDIASKVSSQINPPSDHRGSSWYRREVVKVLTMKA 276 + VK + + I+P D+RG ++R V V+ +A Sbjct: 239 EAVKAAVTAMLEDIDPMPDNRGPVEFKRHVAGVILGRA 276 Lambda K H 0.316 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 284 Length adjustment: 26 Effective length of query: 255 Effective length of database: 258 Effective search space: 65790 Effective search space used: 65790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory