Align glycolaldehyde oxidoreductase medium subunit (characterized)
to candidate 3610814 Dshi_4200 Carbon-monoxide dehydrogenase (acceptor) (RefSeq)
Query= metacyc::MONOMER-18072 (282 letters) >FitnessBrowser__Dino:3610814 Length = 277 Score = 156 bits (395), Expect = 4e-43 Identities = 97/277 (35%), Positives = 160/277 (57%), Gaps = 12/277 (4%) Query: 8 YVRVSSSEEATKFLESHD-DARPLAGGQSLIPMLKLRVISPNYIVDLNPITSLSYVRSSF 66 Y R + EA L + D R LAGGQSLI + +R+ + + +VD++ I L+ V Sbjct: 8 YARANDLREALDLLANADGQGRVLAGGQSLIAAMNMRLSTGDMLVDISRIAELAGVAEDG 67 Query: 67 NSTKIGALTRYNEILKNDLVRVNVPLLHQAVRVVGDMQVRNLGTIGGSAANADPSADIPT 126 + +IGALTR+ + + LV+ +VPLL +A + +RN GTIGG+ ++ADP+A+ P Sbjct: 68 ETLRIGALTRHAAVGADPLVKTHVPLLAEATGHIAHAAIRNRGTIGGALSHADPAAEFPA 127 Query: 127 VLTALNAEIILSSASGNRSVNALDFFKGAFATDLRKGEIISEIVLPNLE-GYRTIYKKVV 185 AL A + ++ G+R+V A DFF+ F T L +GEI++ + +P G + ++V Sbjct: 128 CALALGASMEIAGPDGSRTVAAEDFFEDVFTTALAEGEILTALTVPKQRPGEAQLIEEVA 187 Query: 186 RRAGDFALVSLALAIKLRQNEIEDIRLAYGGVGERPFRALEVEKSVMGKRLNDELVEEIV 245 RR+GD+ALV L L + + R+A VG P A ++ M RL+ ++ V Sbjct: 188 RRSGDYALVGLCLVKRDAGH-----RVALFSVGATPILA----RACMA-RLDAGDLDGAV 237 Query: 246 SKVSSQVNPPSDTRGSSWYRREVMKVITRKALKEVSG 282 + + +++PPSDT+ S+ YRR + V+ R+A+ ++G Sbjct: 238 TALQGEIDPPSDTQASAAYRRHLAGVLLRRAMARLTG 274 Lambda K H 0.317 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 277 Length adjustment: 26 Effective length of query: 256 Effective length of database: 251 Effective search space: 64256 Effective search space used: 64256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory