Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate 3608008 Dshi_1416 ABC transporter related (RefSeq)
Query= reanno::WCS417:GFF4321 (386 letters) >FitnessBrowser__Dino:3608008 Length = 347 Score = 296 bits (758), Expect = 6e-85 Identities = 167/365 (45%), Positives = 227/365 (62%), Gaps = 18/365 (4%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MA + L +V K +G+ + +++ L+I + EFL+L+GPSGCGK+T M IAGLE + G Sbjct: 1 MAEIRLNHVQKRWGSFVG--VEDFHLTIPDREFLVLLGPSGCGKTTTMRMIAGLEEPSSG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I IGD+ V+ + PKDRD+AMVFQSY LYP M+V ENI F LK+RK+P+ + +A V R + Sbjct: 59 EIWIGDRMVNALDPKDRDVAMVFQSYGLYPNMNVYENIRFPLKVRKVPEVEHEARVMRAS 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 +++++ L+RKP LSGGQ+QRVA+ RA+ R P ++L DEPLSNLDAKLRV R ++K Sbjct: 119 AMVELDDFLHRKPAALSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKN 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 + L+ TT+YVTHDQIEAMTL D+V VM G++QQ GTP EIY+ PAN FVASFIGSP Sbjct: 179 LSHELQVTTIYVTHDQIEAMTLADRVVVMSAGVVQQVGTPMEIYDRPANTFVASFIGSPA 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDS 300 MN + +G + G R +A + AG V LG R E + DS Sbjct: 239 MNLM-------EGAVTDGTFHGD-RVAIAGLSGAAG----RVTLGFRAEDAQVV----DS 282 Query: 301 ASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKVLLFDAN 360 I A V E G T+V V+ T V + + ++G + ++ LFDA Sbjct: 283 DGQIAAPVYSMELLGDATMVTVKAGGTLVAVKAPKEFRAEIGAPVQIRIPTGICHLFDAQ 342 Query: 361 TGERL 365 TG L Sbjct: 343 TGVHL 347 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 347 Length adjustment: 30 Effective length of query: 356 Effective length of database: 317 Effective search space: 112852 Effective search space used: 112852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory