Align D-xylonate dehydratase YagF; EC 4.2.1.82 (characterized)
to candidate 3608367 Dshi_1769 6-phosphogluconate dehydratase (RefSeq)
Query= SwissProt::P77596 (655 letters) >FitnessBrowser__Dino:3608367 Length = 601 Score = 162 bits (411), Expect = 3e-44 Identities = 146/486 (30%), Positives = 213/486 (43%), Gaps = 48/486 (9%) Query: 101 KEITRNGGIP--FAAFVSDPCDGRSQGTHGMFDSLPYRNDAAIVFRRLIRSLPTRRAVIG 158 KE R G A V CDG +QG GM SL + D + + S T A Sbjct: 93 KEAARRAGATAQVAGGVPAMCDGVTQGQVGMELSL-FSRDVIALATGVALSHNTFDAAAY 151 Query: 159 VATCDKGLPATMIALAAMHDLPTILVPGGATLPPTVGEDAGKVQTIGARFANHELSLQEA 218 + CDK +P +IA A LP + VP G + + KV+ +FA E+ + Sbjct: 152 LGVCDKIVPGLVIAAATFGYLPGVFVPAGPMVSGLPNDQKAKVRQ---QFAAGEIGRDKL 208 Query: 219 AELGCRACASPGGGCQFLGTAGTSQVVAEALGLALPHSALAPSGQAVWLEIARQSARAVS 278 E + PG C F GTA ++Q++ E +GL LP ++ G + + +A ++ Sbjct: 209 MEAEMASYHGPGT-CTFYGTANSNQMLMEFMGLHLPGASFVNPGTPLREALTAAAAERLA 267 Query: 279 ELDSRGITTR---DILSDKAIENAMVIHAAFGGSTNLLLHIPAIAHAAGCTIPDVEHWTR 335 + G R DIL KA N +V A GGSTNL++H+PA+A AAG I D++ + Sbjct: 268 AITQLGNEYRPVCDILDAKAFVNGIVGLMATGGSTNLVIHLPAMARAAG-VILDLQDFAD 326 Query: 336 INRKVPRLVSVLPNGPDYHPTVRAFLAGGVPEVMLHLRDLGLLHLDAMTVTGQTVG---- 391 I+ P + V PNG AGG+ ++ L GLLH D T+ G + Sbjct: 327 ISEATPLMARVYPNG--LADVNHFHAAGGLAYMIGELLSEGLLHPDTKTIAGDGLADYAR 384 Query: 392 -----ENLEWWQASERRARFRQCLR-EQDGVEPDDVILPPEKAKAKGLTSTVCFPTGNIA 445 + + W+ RR+ + LR DG P + + KG +A Sbjct: 385 EPKLIDGVLRWEDGPRRSLNAKILRPASDGFAPSGGL-----KELKGNLGRGVMKVSAVA 439 Query: 446 PEGSVIKATAIDPSVVGEDGVYHHTGRVRVFVSEAQAIKAIKREEIVQGDIMVVIGGGPS 505 PE VI+A R RVF + A K E + +++V GP Sbjct: 440 PERHVIEA------------------RARVFEDQGAVKDAFKAGEFTEDTVVIVRFQGPK 481 Query: 506 GTGMEETYQLTSALKHI-SWGKTVSLITDARFSGVSTGACFG-HVSPEALAGGPIGKLRD 563 GM E + LT L + G V+L+TD R SG S HV+PEAL GG + K+R Sbjct: 482 ANGMPELHALTPVLAVLQDRGLKVALVTDGRMSGASGKVPAAIHVAPEALDGGLMAKVRT 541 Query: 564 NDIIEI 569 D++ + Sbjct: 542 GDLVRV 547 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 952 Number of extensions: 50 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 601 Length adjustment: 38 Effective length of query: 617 Effective length of database: 563 Effective search space: 347371 Effective search space used: 347371 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory