Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate 3607835 Dshi_1243 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= uniprot:A0A4R8NY47 (263 letters) >FitnessBrowser__Dino:3607835 Length = 258 Score = 215 bits (547), Expect = 8e-61 Identities = 113/250 (45%), Positives = 151/250 (60%), Gaps = 3/250 (1%) Query: 11 HALYRSLAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDA-AVA 69 +A + L G V +TGGGSGIGAAL + F+ QGAQV F I + A VA ++ A A Sbjct: 6 NATFHDLDGASVFVTGGGSGIGAALTDGFLAQGAQVAF--IGRSDASAFVAKMRAAHGRA 63 Query: 70 PRFFPCNLMNLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAYWDERLAVNLR 129 P F ++ + +ALRA + G + L+NNAAND RH + +VTP +WD+ A+NL+ Sbjct: 64 PLFVQGDITDTDALRAAIAQATAAHGPITALVNNAANDKRHSTAEVTPEFWDQMQAINLK 123 Query: 130 HQFFCAQAVLPGMRERKGGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRD 189 FF AQAV PGM E GG I+NF SIS+ +G Y A AGI G+T +AR+FG D Sbjct: 124 AYFFAAQAVTPGMAEAGGGAIVNFSSISYMMGNAGYPAYTAANAGITGLTRSLAREFGPD 183 Query: 190 GVRVNAIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPVRVDPHDVAALALFLSSDSGAKC 249 G+RVNA+ PG + TP+Q +W TPE+ A L QCL + P D+ LFL+S + Sbjct: 184 GIRVNALAPGWVLTPKQLEMWATPEDLAAHLDRQCLKTHLAPEDIVEATLFLASGASKMM 243 Query: 250 TGREYYVDAG 259 TG+ VD G Sbjct: 244 TGQCMVVDGG 253 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 258 Length adjustment: 25 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory