Align D-xylose ABC transporter, periplasmic D-xylose-binding protein (characterized)
to candidate 3608607 Dshi_2000 D-xylose ABC transporter, periplasmic substrate-binding protein (RefSeq)
Query= CharProtDB::CH_003787 (330 letters) >FitnessBrowser__Dino:3608607 Length = 340 Score = 236 bits (603), Expect = 5e-67 Identities = 125/315 (39%), Positives = 191/315 (60%), Gaps = 7/315 (2%) Query: 10 LCTSLLLTNVAAHA-KEVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFVQSANGNEE 68 L +++ V A +V +G++ + + ERW+ D E+ GA A + Sbjct: 6 LAAAIVAAGVTTSAYADVTVGVSWSNFQEERWKTDEAAIKAALEAAGATYVSADAQSSSA 65 Query: 69 TQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDADIDFYISFD 128 Q+S +E++I +GVD L+I+ + Q + V+ A EGI V+ YDR+I D FY++FD Sbjct: 66 KQLSDVESLIAQGVDALIILAQDSQAIGPAVQAAADEGIPVVGYDRLIEDPRA-FYLTFD 124 Query: 129 NEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGKIKVVGDQW 188 N +VG +QA+A+++ P+GNY ++ GSP D NA R GQ ++L+ +D+GKI +VG+ + Sbjct: 125 NVEVGRMQARAVLEQAPEGNYVMIKGSPTDPNADFLRGGQQEILQDAIDAGKITIVGEAY 184 Query: 189 VDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVAISGQDADL 248 DGWLP NA + ME LTA +N++DAVVASND TAGG + AL+AQG+ G + +SGQD D Sbjct: 185 TDGWLPANAQRNMEQILTAQDNQVDAVVASNDGTAGGVVAALTAQGMEG-IPVSGQDGDH 243 Query: 249 AGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQE----PKADTTLNNGLKDVPSRL 304 A + R+A GTQT++V+K L A EIAV + NG A + + G ++ +R Sbjct: 244 AALNRVAKGTQTVSVWKDARDLGRAAGEIAVAMANGTAMADIEGATSWTSPGGTELTARF 303 Query: 305 LTPIDVNKNNIKDTV 319 L P+ V +N+ V Sbjct: 304 LAPVPVTADNLTAVV 318 Lambda K H 0.314 0.132 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 340 Length adjustment: 28 Effective length of query: 302 Effective length of database: 312 Effective search space: 94224 Effective search space used: 94224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory