Align D-xylose ABC transporter, permease protein (characterized)
to candidate 3607867 Dshi_1275 Monosaccharide-transporting ATPase (RefSeq)
Query= CharProtDB::CH_024441 (393 letters) >FitnessBrowser__Dino:3607867 Length = 374 Score = 153 bits (386), Expect = 9e-42 Identities = 115/357 (32%), Positives = 166/357 (46%), Gaps = 26/357 (7%) Query: 36 IIAIMLFFTWTTDGAYLSARNVSNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLG 95 +I + FF D + + V N +A I+AVG ++I+ E DLSVGSM+G G Sbjct: 37 VIVFVFFFLTAFDSGMFTPQGVLNWTLVSAQFMIIAVGACLLMIAGEFDLSVGSMIGFAG 96 Query: 96 GVAAICDVWLGWPLPLTIIVTLVLGLLLGAWNGWWVAYRKVPSFIVTLAGMLAFRGILIG 155 + A+ V L WP+ + I++T + L +GA NG V +PSFIVTLA + RG I Sbjct: 97 MMIAVFGVVLAWPMWIAILITFAICLSIGALNGAIVIRTGLPSFIVTLAFLFILRGFTIF 156 Query: 156 ITNGTTVSPTSAAMSQIGQSYLPASTGFIIGALGLMAFVGW-QWRGRMRRQALGLQSPAS 214 I T + + IG A ++ G G+ QW G + Sbjct: 157 IPQ------TLESKTIIGGIRDAAEGDWLAPVFGGKIGNGFFQWLGDI--------GVIE 202 Query: 215 TAVVGRQALTAIIVLGAIWLLNDYRGVPTPVLLLTLLLLGGMFMATRTAFGRRIYAIGGN 274 T G +A A+I G+P V+ LL+ G + TRT FG I+A GG+ Sbjct: 203 TFSRGNRAGEAVI-----------DGLPMLVIWALLLIAFGHILLTRTRFGNWIFAAGGD 251 Query: 275 LEAARLSGINVERTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGG 334 EAAR SG+ V + K+ +F + G+ G + E +AI A VIGG Sbjct: 252 AEAARNSGVPVNKVKILMFMFTAFCACVFATCQVMEFGSAGADRGLLKEFEAIIAVVIGG 311 Query: 335 TSLAGGVGSVAGAVMGAFIMASLDNGMSMMDVPTFWQYIVKGAILLLAVWMDSATKR 391 L GG GSV GA +GA I + G+ V + + G ILL AV +++ +R Sbjct: 312 ALLTGGYGSVIGAALGALIFGVVQQGLFFAGVESSLFRVFLGVILLGAVILNTYIRR 368 Lambda K H 0.325 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 374 Length adjustment: 30 Effective length of query: 363 Effective length of database: 344 Effective search space: 124872 Effective search space used: 124872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory