Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate 3609044 Dshi_2433 ABC transporter related (RefSeq)
Query= uniprot:Q9WXX0 (520 letters) >FitnessBrowser__Dino:3609044 Length = 510 Score = 405 bits (1041), Expect = e-117 Identities = 216/493 (43%), Positives = 322/493 (65%), Gaps = 10/493 (2%) Query: 20 IVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILVNGERVE 79 I K FPGV A+ +V +Y ++ +LIGENGAGKST++KILTG+ +PD G ILV+G+ V Sbjct: 26 ITKTFPGVKALSDVSLSLYPGKVTALIGENGAGKSTVVKILTGIYQPDGGRILVDGQPVP 85 Query: 80 FHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYMYTRSKE 139 F +P A G++ IHQE L D ++VAENIFL + A RG +D ++ Sbjct: 86 FSTPQAAADHGVTAIHQETVLFDELSVAENIFLGH-APRGA----FGLIDWKKTTENARA 140 Query: 140 LLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETERLFEII 199 LL IGA+ PD +++L A + +V I +AL E R++ MDEPT++L+ +E E L+E++ Sbjct: 141 LLTSIGAELDPDHKLKDLGIANKHLVAIARALSIEARVVIMDEPTAALSHKEIEELYELV 200 Query: 200 EMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIKMMVGREV-E 258 E LK++G +++F+SH+ DE+ RI+D V RDG+ IG+ + ++KMMVGR+V + Sbjct: 201 ESLKAQGKAILFISHKFDEIFRIADNYTVFRDGQLIGDGAIADVTEADLVKMMVGRDVSQ 260 Query: 259 FFPHGIETRPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGAGRTETMLLVFGVN 318 FP G+ L V+ + ++SF +R+GE+LGF GLVGAGR+E M +FG+ Sbjct: 261 IFPQRAPN-VGDTVLTVQGYAHPTEFDDISFTLREGEILGFYGLVGAGRSEFMQSLFGIT 319 Query: 319 QKESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTVKDNIVLPSLKKISRW 378 + +G + + G + EI +P DA+ GI +PEDR QG +L + + N+ LPSL +ISR Sbjct: 320 RPSAGSVEIGGARAEISSPADAVDHGIVYVPEDRGKQGAILDLPIFQNVTLPSLGRISRK 379 Query: 379 GLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLAKWLATNADILIFDEP 438 G L +E ++ +Y +RL ++ S+ NLSGGNQQKVV+AKWLAT ++I DEP Sbjct: 380 GF-LRLAEEFALAREYTERLDLRAASLDTHVGNLSGGNQQKVVIAKWLATRPRVIILDEP 438 Query: 439 TRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVVMWEGEITAVLDNREK 498 T+G+D+G+KA +H + ELAAQG AVIM+SSE+PE+L +SDR++VM EG I A L + Sbjct: 439 TKGVDIGSKAAVHDFMAELAAQGLAVIMVSSEIPEVLGMSDRVIVMREGRIVAELAGDD- 497 Query: 499 RVTQEEIMYYASG 511 + E ++ +A+G Sbjct: 498 -LQPETLVRHAAG 509 Lambda K H 0.319 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 634 Number of extensions: 30 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 510 Length adjustment: 35 Effective length of query: 485 Effective length of database: 475 Effective search space: 230375 Effective search space used: 230375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory