Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate N515DRAFT_0941 N515DRAFT_0941 isovaleryl-CoA dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >FitnessBrowser__Dyella79:N515DRAFT_0941 Length = 385 Score = 244 bits (624), Expect = 2e-69 Identities = 146/377 (38%), Positives = 215/377 (57%), Gaps = 5/377 (1%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKSLFPEYARDLFAKLGLLNPLLPAAYGGTEM 63 L EE L + V A +EIAPRA ++D ++FP F ++GLL +P AYGGT + Sbjct: 6 LGEELDLLRESVHAFAEKEIAPRATQIDHDNVFPADLWRKFGEMGLLGMTIPEAYGGTGL 65 Query: 64 GVLTLALILEELGRVCASTALLLIAQTDGMLP-IIHGGSPELKERYLRRFAGESTLLTAL 122 G L + +EE+ R S L A ++ + + H G+ E + +Y+ R + AL Sbjct: 66 GYLAHMVAMEEISRASGSVGLSYGAHSNLCVQNLFHNGNEEQRRKYIPRLCS-GEYVGAL 124 Query: 123 AATEPAAGSDLL-AMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPEK-GSKGI 180 A +EP AGSD++ +M +A +GD +V NG K +ITNG ADV++VY T P GS+ + Sbjct: 125 AMSEPGAGSDVVGSMSCKAELRGDVWVANGTKMWITNGPDADVLLVYMRTAPRPAGSRCM 184 Query: 181 SAFVVEKGTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAEGTGFANLMQTLST 240 +AF++EKG G + K+GMRGS EL FE+ E+PA NI+G G LM L T Sbjct: 185 TAFIIEKGMKGFSTAQKLDKLGMRGSNTCELVFEDCEIPAANIVGEVNEGVRVLMSGLDT 244 Query: 241 NRVFCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEASRLLTRK 300 R+ + +G+ Q A+D+ + + ++R QF PI +Q VADM TA+++SR Sbjct: 245 ERLVLSGGPLGLMQAAMDLVLPYVRERKQFNAPIGTFGMMQAKVADMYTALQSSRGFAYM 304 Query: 301 AAELLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMRDAKLTQ 360 A D G K + + AS A++V +A+Q LGG+GY+ E R++RDAKL + Sbjct: 305 VAREFDQGSKSRI-DPAACLLNASQNAVKVALEAIQALGGNGYINEFPAGRLLRDAKLYE 363 Query: 361 IYTGTNQITRMVTGRAL 377 I GTN+I RM+ GR L Sbjct: 364 IGAGTNEIRRMLIGREL 380 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 385 Length adjustment: 30 Effective length of query: 350 Effective length of database: 355 Effective search space: 124250 Effective search space used: 124250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory