GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cycA in Dyella japonica UNC79MFTsu3.2

Align D-serine/D-alanine/glycine transporter (characterized)
to candidate N515DRAFT_2630 N515DRAFT_2630 amino acid/polyamine/organocation transporter, APC superfamily

Query= SwissProt::P0AAE0
         (470 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2630 N515DRAFT_2630 amino
           acid/polyamine/organocation transporter, APC superfamily
          Length = 454

 Score =  387 bits (993), Expect = e-112
 Identities = 197/454 (43%), Positives = 286/454 (62%), Gaps = 12/454 (2%)

Query: 18  SLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGEL 77
           SL+R L  RHI+L+A+G AIG GLF+GS   I LAGP+I+  Y++ G  +F +MRA+GE+
Sbjct: 6   SLQRGLQERHIRLMALGSAIGVGLFLGSANAIRLAGPAILLSYLLGGVAIFIIMRALGEM 65

Query: 78  LLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWV 137
            + N    SFS +A D LGP  GY TGW YWF W++T +A++ A+  Y   WFPD+  W+
Sbjct: 66  AVQNPVAGSFSRYAQDYLGPLPGYLTGWNYWFMWLMTCIAEITAVGVYMGVWFPDVPQWI 125

Query: 138 ASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHFQSPTGVEASF 197
            +LA +V +  +NLA VK +GE EFWFAMIK+V IV +IV G  M+     +  GV    
Sbjct: 126 WALAALVTMGAVNLAAVKAYGEFEFWFAMIKVVTIVLMIVGGGAMIVFGLGN-QGVPTGI 184

Query: 198 AHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPIRII 257
           ++LW  GG+ P G  G     Q+ +FA++G+E++G TA E  +P+KS+P AINS+  RI+
Sbjct: 185 SNLWTHGGFMPNGAKGMLMALQMVMFAYLGVEMIGLTAGEADNPKKSIPDAINSVFWRIL 244

Query: 258 MFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVINFVVLTSAASSANSGVFS 317
           +FYV AL VIMS+ PW+ +    SPFV  F  +G+ +AA +INFVVLT+A SS N G++S
Sbjct: 245 IFYVGALFVIMSIYPWNELGTHGSPFVMTFERLGIKSAAGIINFVVLTAALSSCNGGIYS 304

Query: 318 TSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLYVNPSVIGAFTMITT 377
           T RMLF LAQ+G AP+ FA  S   +P + +  S + LL GV++ Y+ P+ +  F  +T+
Sbjct: 305 TGRMLFNLAQQGQAPRTFAVTSPSGIPNRAVLVSLVALLFGVLLNYLVPAKV--FVWVTS 362

Query: 378 VSAILFMFVWTIILCSYLVYRK-----QRPHLHEKSIYKMPLGKLMCWVCMAFFVFVVVL 432
            +    ++ W I+L + + YR+     QR  L    +++MP      ++ +AF V VV L
Sbjct: 363 AATFGAIWTWGIVLITQMKYRRGLSEAQRSQL----VFRMPFFPYASYLALAFLVLVVGL 418

Query: 433 LTLEDDTRQALLVTPLWFIALGLGWLFIGKKRAA 466
           +    DTR AL+V PLW + L + +   G  R A
Sbjct: 419 MGYFPDTRVALIVGPLWLVLLTVLYYVFGLGRRA 452


Lambda     K      H
   0.329    0.141    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 658
Number of extensions: 37
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 470
Length of database: 454
Length adjustment: 33
Effective length of query: 437
Effective length of database: 421
Effective search space:   183977
Effective search space used:   183977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory