Align D-serine transporter DsdX (characterized)
to candidate N515DRAFT_2225 N515DRAFT_2225 gluconate permease GntT (TC 2.A.8.1.4)
Query= SwissProt::P08555 (445 letters) >FitnessBrowser__Dyella79:N515DRAFT_2225 Length = 457 Score = 305 bits (780), Expect = 3e-87 Identities = 173/443 (39%), Positives = 259/443 (58%), Gaps = 17/443 (3%) Query: 13 ISIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAVIGL 72 +++V+++ I K +PF+ALL+ S +G +GM +V A E+G GGTLG +A +I L Sbjct: 21 LAVVVLIYLIAALKLNPFVALLMVSLGLGVAVGMPMKGIVKAFETGAGGTLGHIALLIAL 80 Query: 73 GTILGKMMEVSGAAERIGLTL------QRCRWLSVDVIMVLVGLICGITLFVEVGVVLLI 126 GT+LGKMM SG ERI TL +R W M+ V I G+ +F +VG VLL+ Sbjct: 81 GTMLGKMMAESGGTERIAHTLIAAFGERRAHWA-----MMTVAFIVGLPVFFDVGFVLLV 135 Query: 127 PLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGADIGSVIVYGLLVG 186 P+AF IAK+ LL + + + L VH +VPPHPAAL ADIG I+Y +L+G Sbjct: 136 PVAFHIAKRAGMPLLLIGLSMSAGLSVVHGLVPPHPAALLAVTAYQADIGKTILYAVLIG 195 Query: 187 LMASLIGGPLFLKFLGQRLPFK---PVPTEFADLKVRDEKTLPSLGATLFTILLPIALML 243 L ++I GPLF +++ + + + P+ EF ++ E+ LPS G L T+LLP+ LML Sbjct: 196 LPTAIIAGPLFARWVTRYVTVEAENPLEKEFVEID--QERQLPSFGIALATLLLPVLLML 253 Query: 244 VKTIAELNMARESGLYILVEFIGNPITAMFIAVFVAYYVLGIRQHMSMGTMLTHTENGFG 303 V T A+L S ++ F+GNP+ A+ +AV +++Y G R+ S T+L T + Sbjct: 254 VGTWADLLSTPGSRANAVLGFLGNPVVALLVAVLLSFYTFGKRRGFSRETILGFTNDCLA 313 Query: 304 SIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSATVA 363 A ++L++GAGG F IL S ++ + + + P+LL WL+A +L A GSATVA Sbjct: 314 PTATVILVVGAGGGFGRILLDSGVSHAIIGATQSSQISPLLLGWLIAALLRIATGSATVA 373 Query: 364 MMGATAIVAPMLPLYPD-ISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKY 422 M A IVAP+ + PE++ +A G+G++ + V D FW+VKQY T+ +T K Sbjct: 374 MGTACGIVAPIAAAASKAVHPELMVLATGAGSLILSHVNDGGFWIVKQYFNMTVTQTLKT 433 Query: 423 YTTATFIASVVALAGTFLLSFII 445 +T I SVVAL T L+ ++ Sbjct: 434 WTVLETIISVVALLLTLGLAAVL 456 Lambda K H 0.329 0.143 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 457 Length adjustment: 33 Effective length of query: 412 Effective length of database: 424 Effective search space: 174688 Effective search space used: 174688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory