Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate N515DRAFT_4298 N515DRAFT_4298 glutamine--fructose-6-phosphate transaminase
Query= reanno::Korea:Ga0059261_1644 (347 letters) >FitnessBrowser__Dyella79:N515DRAFT_4298 Length = 609 Score = 140 bits (353), Expect = 9e-38 Identities = 106/311 (34%), Positives = 158/311 (50%), Gaps = 22/311 (7%) Query: 51 VVTCARGSSDHAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSP 110 ++ C G+S HA AKY IE +P + ++ Y V P L +AISQSG++ Sbjct: 297 IIAC--GTSYHAGLVAKYWIEDYARLPV-NVEVASEYRYREAVVPDGTLFVAISQSGETA 353 Query: 111 DLLATVEHQRKAGAF-VVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIA 169 D LA + R+ G +A+ N +S + AD+ + +AGPE VA+TK++ LAA+ Sbjct: 354 DTLAAMRESRRRGYLGTLAICNVPESSVVREADLKLMTRAGPEIGVASTKAFTTQLAALG 413 Query: 170 ALVAAWAQDEALETA-VADLPAQL-------ERAFALDWSAAVTA--LTGASGLFVLGRG 219 L A+ L+ A ADL AQL E+A L+ A L LGRG Sbjct: 414 LLALQLARHRGLDDARYADLTAQLQSLPKKIEKALELEPQIVDLAEHLIHRQHALFLGRG 473 Query: 220 YGYGIAQEAALKFKETCALHAESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETV 279 Y +A E ALK KE +HAE+++A E++HGP+A+V E V+A A + + ++ + Sbjct: 474 AQYPVAMEGALKLKEISYIHAEAYAAGELKHGPLALVDEDMPVIAVAPNGPLLDKLKSNL 533 Query: 280 AEFRSRGAEVLL-ADPAARQAGLPAIAAHPAIE-------PILIVQSFYKMANALALARG 331 E R+RG E+L+ AD AA G A + I+ P + +A +A+ RG Sbjct: 534 QEVRARGGELLVFADGAASMDGNAARGSILRIDGGGDFIAPAVFTVPMQLLAYHVAVLRG 593 Query: 332 CDPDSPPHLNK 342 D D P +L K Sbjct: 594 TDVDQPRNLAK 604 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 609 Length adjustment: 33 Effective length of query: 314 Effective length of database: 576 Effective search space: 180864 Effective search space used: 180864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory