Align Glucose kinase (characterized, see rationale)
to candidate N515DRAFT_0593 N515DRAFT_0593 glucokinase
Query= uniprot:Q8P6M4 (344 letters) >FitnessBrowser__Dyella79:N515DRAFT_0593 Length = 353 Score = 308 bits (790), Expect = 1e-88 Identities = 169/327 (51%), Positives = 215/327 (65%), Gaps = 12/327 (3%) Query: 22 FLAADVGGTHVRVGRVSHGADA--PIELSQYRTYRCADHASLDAILADF---LRDSRAVD 76 FLAADVGGTH R+G VS D P+ + QY Y CA+ SL A+L DF L + VD Sbjct: 20 FLAADVGGTHARIGLVSQRPDGARPVTVLQYHRYACAEWPSLTAVLKDFVSQLGGAVQVD 79 Query: 77 AVVIASAGVALDDGRFISNNLPWTIAPRQLRDTLGVRAVHLVNDFEAVAYAAPQMEQRAV 136 +ASAG L D +++NLPW ++ R +RD+LG+ + +VNDFEAVAYA Q V Sbjct: 80 QCAVASAGYVLGDA-IVNDNLPWPVSIRDIRDSLGIERLAVVNDFEAVAYAT----QFLV 134 Query: 137 VQLSGPTPRHAQPGG--PILVVGPGTGLGAAVWINGPRQPTVLATEAGQVALASNDPDTA 194 + P PGG P+LV+GPGTGLG+AV + G TVLATEAGQ+AL+ + Sbjct: 135 HADTTPVIEAQTPGGVGPVLVMGPGTGLGSAVLLPGKPHATVLATEAGQIALSPGNEREI 194 Query: 195 QVLRILARDASYLPIEHVLSGPGLRNLYLALCELHAATPIHPLPADITHAALHSDDALAR 254 ++LR+LA + Y+ EH LSGPGL NLY ALC L +P+ P++IT AAL + DA A Sbjct: 195 EILRVLAGERPYVSFEHALSGPGLLNLYRALCVLRGQSPVLAKPSEITRAALDASDAAAV 254 Query: 255 RCLQLFCALLGSAVGDMALAYGASGGVYLAGGILPSIGQFLAASDFRERFLAKGRMRPVL 314 L++FC LLGS VGD+ L YGA GGV+LAGGILP I L S FRERF KG MR L Sbjct: 255 EALEVFCGLLGSFVGDLTLLYGARGGVFLAGGILPQIRDVLLTSSFRERFFNKGVMRAFL 314 Query: 315 ERIPVKLVEHGQLGVLGAASWYLQHHT 341 +++PV+L+EHGQLGV+GAA YL+ HT Sbjct: 315 QQVPVRLMEHGQLGVIGAAGMYLEGHT 341 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 353 Length adjustment: 29 Effective length of query: 315 Effective length of database: 324 Effective search space: 102060 Effective search space used: 102060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory