Align putative transporter, required for glycine and L-alanine utilization (characterized)
to candidate N515DRAFT_2693 N515DRAFT_2693 Uncharacterized membrane protein YeiH
Query= reanno::ANA3:7023996 (213 letters) >FitnessBrowser__Dyella79:N515DRAFT_2693 Length = 210 Score = 132 bits (332), Expect = 5e-36 Identities = 67/192 (34%), Positives = 112/192 (58%) Query: 9 LLWLIGILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLIWVENVHY 68 +L L+G A++GAL R+Q+DLFGV+++ A GG RD+L+G P + + Y Sbjct: 8 VLDLLGTFVFALSGALTGVRRQLDLFGVLVLSFAAGNAGGITRDLLIGATPPAAIADWRY 67 Query: 69 LLAIAFASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLV 128 L A ++T ++ L DA GLA+F++ GAQK L G +P +A ++G++ Sbjct: 68 LAVSMLAGIVTFYRYALIERLKNPVQLSDAAGLALFAVAGAQKALAHGLNPAMAALLGML 127 Query: 129 TGVFGGVIRDILCNQVPLIFKKELYAVISLFTAGLYITLNAYQLAEWINLVVCLTLGFSL 188 TGV GG++RD+L Q+P + + +LYAV +L A + + + Q+ ++ + + F L Sbjct: 128 TGVGGGILRDVLVTQIPTVLRADLYAVAALAGAAIVVAGDLLQVPPAVSTLAGAAVCFGL 187 Query: 189 RMLALRYHWSMP 200 R +A+RY W +P Sbjct: 188 RFMAIRYGWHLP 199 Lambda K H 0.330 0.143 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 210 Length adjustment: 21 Effective length of query: 192 Effective length of database: 189 Effective search space: 36288 Effective search space used: 36288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory