Align Inner-membrane translocator (characterized, see rationale)
to candidate N515DRAFT_2414 N515DRAFT_2414 simple sugar transport system permease protein
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__Dyella79:N515DRAFT_2414 Length = 358 Score = 292 bits (748), Expect = 9e-84 Identities = 163/324 (50%), Positives = 220/324 (67%), Gaps = 10/324 (3%) Query: 63 LWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIATGG 122 LWPLL L +LL N + F + ++D LYG+LIDI +R+AP+AL+S+GM+LVIA G Sbjct: 31 LWPLLTLILLLAGNGLFNPGFLALQWRDGHLYGNLIDIAHRAAPLALVSLGMTLVIALRG 90 Query: 123 IDLSVGAVMAIAGAVCA-------NLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLG 175 +D+SVGAV+AIA V A N L+P L IAA L G L G NG LV G Sbjct: 91 LDISVGAVLAIAATVAAWTIGHVSNDGLLP---LWLAIAAALAAGALCGLWNGWLVVGAG 147 Query: 176 IQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVWIVIGMLTFSQ 235 +QPIVATL+LMVAGRG+AQ I+ GQI+T + ++ +G G LGLP +++V + Q Sbjct: 148 MQPIVATLILMVAGRGIAQSISGGQILTLYYAPYSFLGNGFVLGLPFSLFVVAAVFALLQ 207 Query: 236 LLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDA 295 L LRKTALGLF+ A+G N +A+ G+ ++I L AY G+ AALAG++ ++++ +DA Sbjct: 208 LALRKTALGLFVRAIGHNPQAAHVAGVRARAITLGAYVFCGIAAALAGLLVSSNVNSADA 267 Query: 296 NNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIK 355 NNAGL LELDA+LAV +GG+ L GGRFSL S++GALIIQ L TTI G+P + NL +K Sbjct: 268 NNAGLLLELDAILAVALGGSLLGGGRFSLAGSLLGALIIQALTTTIYAIGVPPQVNLAVK 327 Query: 356 AIVILTVLLLQSAKFRRQLSALFK 379 A+++ V+LLQS R QL AL + Sbjct: 328 AVLVFAVMLLQSPLCRGQLRALLR 351 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 358 Length adjustment: 30 Effective length of query: 375 Effective length of database: 328 Effective search space: 123000 Effective search space used: 123000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory