Align CVE1 aka ChvE aka ATU2348 aka AGR_C_4267, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate N515DRAFT_3231 N515DRAFT_3231 xylose-binding protein
Query= TCDB::P25548 (354 letters) >FitnessBrowser__Dyella79:N515DRAFT_3231 Length = 341 Score = 170 bits (430), Expect = 6e-47 Identities = 112/350 (32%), Positives = 179/350 (51%), Gaps = 21/350 (6%) Query: 4 IISLMAACAIGAASFAAPAFAQDKGSVGIAMPTKSSARWIDDGNNIVKQLQEAGYKTDLQ 63 +++L+A AA A A D+ +G ++ RW D + V ++ G K +Q Sbjct: 9 LLALVATGLAVAALTACSGKASDQPKIGFSIDDMRLERWTRDRDYFVAAAEKLGAKVYVQ 68 Query: 64 YADDDIPNQLSQIENMVTKGVKVLVIASIDGTTLSDVLKQAGEQGIKVIAYDRLIRNSGD 123 AD + Q+ Q+EN++++GV VLVI + L +V+ +A GIKVI+YDRLI + D Sbjct: 69 SADGNEQRQVQQLENLISRGVNVLVIVPFNSKVLDNVIAEAKRNGIKVISYDRLILGA-D 127 Query: 124 VSYYATFDNFQVGVLQATSITDKLGLKDGKGPFNIELFGGSPDDNNAFFFYDGAMSVLKP 183 V Y +FDN +VG LQA + D + KG N L GGSP DNNA +G + VL+P Sbjct: 128 VDAYISFDNEKVGELQAQGVLDAV----PKG--NYFLLGGSPTDNNAKILREGQLKVLQP 181 Query: 184 YIDSGKLVVKSGQMGMDKVGTLRWDPATAQARMDNLLSAYYTDAKVDAVLSPYDGLSIGI 243 ID G + + Q T WD + A +++ L+A + D + +++ D + G Sbjct: 182 AIDRGDVKIVGQQW------TPEWDASKALRIVEDALTANHND--IQGIVASNDATAGGA 233 Query: 244 ISSLKGVGYGTKDQPLPVVSGQDAEVPSVKSIIAGEQYSTIFKDTRELAKVTVNMVNAVM 303 I +L K VSGQDA++ V+ ++ G Q T++K + +A + + Sbjct: 234 IQALAAQQLAGK----VAVSGQDADLAGVRRVVDGTQAMTVYKPLKTIATTAAELAVKLA 289 Query: 304 EGKEPEVNDTKTYENGVKVVPSYLLKPVAVTKENYKQVLVDGGYYKEDQL 353 +G+ P T NG K V S LL+P +TK+ ++ G+Y +Q+ Sbjct: 290 KGEAPTY--TGKMNNGKKDVDSVLLQPTLLTKDKVDDTVIKDGFYTREQI 337 Lambda K H 0.314 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 341 Length adjustment: 29 Effective length of query: 325 Effective length of database: 312 Effective search space: 101400 Effective search space used: 101400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory