Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate N515DRAFT_1687 N515DRAFT_1687 ABC-2 type transport system ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__Dyella79:N515DRAFT_1687 Length = 324 Score = 122 bits (307), Expect = 1e-32 Identities = 77/223 (34%), Positives = 122/223 (54%), Gaps = 12/223 (5%) Query: 4 IQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIG 63 I+ LTKRFG+ AVD + L++ +GP+G GKSTT+RML GL TP+ G+I Sbjct: 12 IRARGLTKRFGNFTAVDHVDLEVPARHVYGFLGPNGSGKSTTIRMLCGLLTPSEGEI--- 68 Query: 64 GDHMNYRVPQNRD-----IAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEV 118 D + VP+ + I + Q ++L+ + VR+N++F + +G A +R+ E+ Sbjct: 69 -DVLGLSVPREAEALRKRIGYMTQKFSLFDDLGVRENLQF-MAAVQGVPKARTRQRIDEL 126 Query: 119 AETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQ 178 E D + +SGGQ+QR+AL A++ DPE+ +DEP S +D + R + +L Sbjct: 127 IEQYHFGDRQKQLAGTMSGGQKQRLALACAVIHDPELLFLDEPTSAVDPESRRDFWEKLF 186 Query: 179 NLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFE 221 L D A TT+ V+ + + R+AV+D G L +P E Sbjct: 187 ELTD--AGTTMLVSTHLMDEAERCHRLAVLDRGVLVADGTPAE 227 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 324 Length adjustment: 29 Effective length of query: 354 Effective length of database: 295 Effective search space: 104430 Effective search space used: 104430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory