GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PRO3 in Dyella japonica UNC79MFTsu3.2

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate N515DRAFT_1783 N515DRAFT_1783 pyrroline-5-carboxylate reductase

Query= SwissProt::P22008
         (273 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_1783 N515DRAFT_1783
           pyrroline-5-carboxylate reductase
          Length = 274

 Score =  256 bits (653), Expect = 5e-73
 Identities = 137/268 (51%), Positives = 180/268 (67%), Gaps = 1/268 (0%)

Query: 5   RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADA 64
           RIAFIG GNMA SLIGGL   G+ A+ +  ++P AE R ++  EF +        AVA+A
Sbjct: 3   RIAFIGGGNMARSLIGGLLKTGIAASSVSVAEPRAEARQELGREFGVACYAEARPAVAEA 62

Query: 65  DVVVLSVKPQAMKAVCQALAPALKPEQ-LIVSIAAGIPCASLEAWLGQPRPVVRCMPNTP 123
           +VVVL+VKPQ + A+   L   L+  + +++SIAAG+    LE WLG   P+VRCMPNTP
Sbjct: 63  EVVVLAVKPQVLPALRNELQDVLRQRRPMLISIAAGVRIDQLERWLGGQLPIVRCMPNTP 122

Query: 124 ALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLL 183
           AL+  GA+GL AN +VS  Q   A ++L A G+  W+DDEA +D VTA+SGSGPAYFF L
Sbjct: 123 ALIGAGATGLCANGRVSPPQRALAQRILDAAGLTRWIDDEALMDTVTALSGSGPAYFFAL 182

Query: 184 MQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKS 243
           ++A+ DA    G+ RETA  L  QT LGA +M   S   PAELRRRVTSPNGTT+AA++S
Sbjct: 183 VEALEDAAVAQGMPRETARALAAQTCLGAGRMLAESGEAPAELRRRVTSPNGTTQAALES 242

Query: 244 FQANGFEALVEQALNAASQRSAELAEQL 271
           F A+G   +V +A+ AA++R   LA  L
Sbjct: 243 FAADGLPRIVARAVAAATRRGEALAAAL 270


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 218
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 274
Length adjustment: 25
Effective length of query: 248
Effective length of database: 249
Effective search space:    61752
Effective search space used:    61752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate N515DRAFT_1783 N515DRAFT_1783 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00112.hmm
# target sequence database:        /tmp/gapView.14725.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    2.6e-89  285.3   0.8    2.9e-89  285.2   0.8    1.0  1  lcl|FitnessBrowser__Dyella79:N515DRAFT_1783  N515DRAFT_1783 pyrroline-5-carbo


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dyella79:N515DRAFT_1783  N515DRAFT_1783 pyrroline-5-carboxylate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  285.2   0.8   2.9e-89   2.9e-89       1     263 []       4     266 ..       4     266 .. 0.98

  Alignments for each domain:
  == domain 1  score: 285.2 bits;  conditional E-value: 2.9e-89
                                    TIGR00112   1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvlla 66 
                                                  ia+iG+Gnm+++l+ gllk+g + ++++ v+e+++e++++l  e+gv+ +++a+ av+ea+vv+la
  lcl|FitnessBrowser__Dyella79:N515DRAFT_1783   4 IAFIGGGNMARSLIGGLLKTGIA-ASSVSVAEPRAEARQELGREFGVACYAEARPAVAEAEVVVLA 68 
                                                  89*****************9766.8***************************************** PP

                                    TIGR00112  67 vKPqdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaa 132
                                                  vKPq+l+++ +el++  +++  +liSi+AGv+i++le++l+++ ++vR+mPNt+a +gag+t+++a
  lcl|FitnessBrowser__Dyella79:N515DRAFT_1783  69 VKPQVLPALRNELQDVLRQRRPMLISIAAGVRIDQLERWLGGQLPIVRCMPNTPALIGAGATGLCA 134
                                                  ***************9999*********************************************** PP

                                    TIGR00112 133 ssevseeqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreea 197
                                                  + +vs+ q++l++++l+a G + +++ e+l+d+vtalsGSgPA++f l+eal+da+v++G+pre+a
  lcl|FitnessBrowser__Dyella79:N515DRAFT_1783 135 NGRVSPPQRALAQRILDAAGLTRWIDdEALMDTVTALSGSGPAYFFALVEALEDAAVAQGMPRETA 200
                                                  ****************************************************************** PP

                                    TIGR00112 198 kelaaqtlkGaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263
                                                  ++laaqt  Ga+++l+esge pa+L+ +VtsP+GtT+a+l+++ ++g+ + v++av aa++r e L
  lcl|FitnessBrowser__Dyella79:N515DRAFT_1783 201 RALAAQTCLGAGRMLAESGEAPAELRRRVTSPNGTTQAALESFAADGLPRIVARAVAAATRRGEAL 266
                                                  **************************************************************8865 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (274 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 3.11
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory