Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate N515DRAFT_3588 N515DRAFT_3588 ABC-2 type transport system ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__Dyella79:N515DRAFT_3588 Length = 308 Score = 108 bits (270), Expect = 1e-28 Identities = 77/227 (33%), Positives = 116/227 (51%), Gaps = 9/227 (3%) Query: 7 TGQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTG 66 TG P+ Q++ V YGN A+ G+D+ +++GEI +L+G NGAGKST + + G + G Sbjct: 4 TGSPIAQLSSVVKRYGNHTAVDGLDLMLHRGEIFALLGPNGAGKSTTISMLLGLARPDAG 63 Query: 67 SVVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKI 126 V G D P +AR RI + + P + V E L++ A + ++ Sbjct: 64 RVELFGED----PQQLVARRRIGVMLQSAALPPTLRVGELLRLTASYYPAPRDERETAEL 119 Query: 127 FTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAI 186 + LK +A LSGG+Q+ + AL RP+LL LDEP++G+ + ++ A+ Sbjct: 120 AGVADLLKRPYA----ALSGGQQRRVQFALALCGRPELLFLDEPTVGMDLEARQKLWVAL 175 Query: 187 RKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLA 233 R L AEG V L A L+HR VM G+V GS +L A Sbjct: 176 RHL-VAEGAGVVLTTHYLEEAEALAHRVCVMARGRVLSEGSVDDLRA 221 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 308 Length adjustment: 25 Effective length of query: 222 Effective length of database: 283 Effective search space: 62826 Effective search space used: 62826 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory