Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate N515DRAFT_1074 N515DRAFT_1074 3-hydroxyisobutyrate dehydrogenase
Query= metacyc::MONOMER-15565 (287 letters) >FitnessBrowser__Dyella79:N515DRAFT_1074 Length = 292 Score = 130 bits (326), Expect = 4e-35 Identities = 85/281 (30%), Positives = 143/281 (50%), Gaps = 4/281 (1%) Query: 3 EIGFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKYTI 62 ++GF+G+G MG AMA NLL+ G VTVWNR+ L GA V TP + + Sbjct: 2 KVGFIGLGAMGSAMASNLLKAGHSVTVWNRSPEATAPLASLGAKVASTPQRAAQG-EALF 60 Query: 63 AMLSDPAAALSVVFDKHGALEHICAGKGYIDMSTVDADTSSQISQAITSKGGSFLEAPVS 122 +MLS+ A VV D G LE + G +++ +TV + +++ A +G ++ APV Sbjct: 61 SMLSNDQAVREVVLDS-GLLEEMDKGTVHVNHATVSVALARELASAHAQRGLDYVAAPVF 119 Query: 123 GSKKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAK-MKLVVNMIMGSM 181 G A G+L I+ AG + ++V P + +G + +G+ A +K+ N ++G+ Sbjct: 120 GRPDVAAAGRLNIVVAGKPAVLERVRPLLEAMGSAIWPMGEEAERANVVKIAGNFMLGAA 179 Query: 182 MNAFSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYPPA-FPLKHQQKD 240 + + +E L G+ L V+ A P ++ + + + PA F L KD Sbjct: 180 IESMAEASALTRAHGVSAGDFLHVMTSTLFAAPPYQGYAKLIAEQRFKPAGFALPLGYKD 239 Query: 241 MRLALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAV 281 + LAL+ D VP+P A+ ++ + +LG D+D+SA+ Sbjct: 240 INLALSAADATRVPLPFASVLRDSLLETLALGDEDVDWSAL 280 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 292 Length adjustment: 26 Effective length of query: 261 Effective length of database: 266 Effective search space: 69426 Effective search space used: 69426 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory