Align Amino-acid permease RocE (characterized)
to candidate N515DRAFT_3653 N515DRAFT_3653 amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)
Query= SwissProt::P39137 (467 letters) >FitnessBrowser__Dyella79:N515DRAFT_3653 Length = 453 Score = 305 bits (781), Expect = 2e-87 Identities = 156/444 (35%), Positives = 256/444 (57%), Gaps = 9/444 (2%) Query: 11 LQRTMKSRHLFMISLGGVIGTGFFLGTGFTINQAGPLGAVLSYLVGGFIMFLTMLCLGEL 70 LQR + RH+ ++LG IG G FLG+ IN AGP + +YL GG ++F+ M LGE+ Sbjct: 5 LQRRLTPRHITFMALGMAIGAGLFLGSANAINLAGP-SVLFAYLFGGAMIFIIMRALGEM 63 Query: 71 AVAFPVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQLMQRWFPHIDVWI 130 AV PV+GSF TYA +++ P G+ GW YW+ E + G M++WFP + WI Sbjct: 64 AVHDPVAGSFSTYAHRYLGPFAGYLTGWNYWILMVGVGMAESTAVGIYMRQWFPELPQWI 123 Query: 131 WCLVFAALMFILNAITTKAFAESEFWFSGIKILIILLFIILGGAAMFGLIDLKGGEQAPF 190 W A++ LN + K + E EFWF+ IK++ ++L +ILGGA M L GG+ Sbjct: 124 WVFGSVAMIGGLNLMAVKVYGEMEFWFTLIKVVTVVL-MILGGAGMIWLGWGNGGQPVGL 182 Query: 191 LTHFYEDGLFPNGIKAMLITMITVNFAFQGTELIGVAAGESEDPEKTIPRSIKQTVWRTL 250 + G FP+G M++ + V FAF G E IG+AAGE+ PE+TIPR++ +WR L Sbjct: 183 ANLWSHGGWFPHGFTGMVLALPVVVFAFGGIETIGMAAGEAAQPERTIPRAVNSVLWRIL 242 Query: 251 VFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIPYAADIMNFVILIALLSVANSGLYA 310 +F+V ++ VI + PW Q G SPFV F ++GIP AA ++NFV++ A LS NS ++ Sbjct: 243 IFYVGALFVIMAIYPWDQLGTQGSPFVTTFGKLGIPQAAGLINFVVITAALSGFNSTTFS 302 Query: 311 STRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKFAQAETVYMVLLSLA 370 +R+LY+++ + QA LG+ ++ GVP+ +++VT+A ++ + E ++ +++S+ Sbjct: 303 GSRMLYSLSTKAQAPAFLGQVSEHGVPVRAVLVTLACLVFGVVLNYLLPERIFAMMMSIL 362 Query: 371 GMSAQVGWITISLSQIMFRRKYIREGGKIEDLKFKTPLYPVLPLIGLTLNTVVLISLAFD 430 + W+ + ++ FRR++ F +P+ ++ L VL L + Sbjct: 363 AFNTVWTWMMVLIAHYSFRRRH-------GATAFPLRAWPLTSVVCLLFLAFVLFMLGYS 415 Query: 431 PEQRIALYCGVPFMIICYIIYHVV 454 + R+ALY G ++++ + Y ++ Sbjct: 416 ADTRVALYVGAGWVVLLSLAYRLL 439 Lambda K H 0.329 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 467 Length of database: 453 Length adjustment: 33 Effective length of query: 434 Effective length of database: 420 Effective search space: 182280 Effective search space used: 182280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory