Align Arginase (EC 3.5.3.1) (characterized)
to candidate N515DRAFT_0348 N515DRAFT_0348 arginase
Query= reanno::Dyella79:N515DRAFT_0348 (304 letters) >FitnessBrowser__Dyella79:N515DRAFT_0348 Length = 304 Score = 613 bits (1581), Expect = e-180 Identities = 304/304 (100%), Positives = 304/304 (100%) Query: 1 MGNQAVSLIGAPTDIGAGHRGASMGPEALRVANLQARLKARGIDVVDRGNLQGPLNPWEP 60 MGNQAVSLIGAPTDIGAGHRGASMGPEALRVANLQARLKARGIDVVDRGNLQGPLNPWEP Sbjct: 1 MGNQAVSLIGAPTDIGAGHRGASMGPEALRVANLQARLKARGIDVVDRGNLQGPLNPWEP 60 Query: 61 PREGYRHLSAVVDWNRAVYEAIYGELSLGRLPVMLGGDHCLAIGSITAVARHCREHHKKL 120 PREGYRHLSAVVDWNRAVYEAIYGELSLGRLPVMLGGDHCLAIGSITAVARHCREHHKKL Sbjct: 61 PREGYRHLSAVVDWNRAVYEAIYGELSLGRLPVMLGGDHCLAIGSITAVARHCREHHKKL 120 Query: 121 RVLWLDAHADFNTAQITPSGNIHGMPVACLCGMGPEELTTLGGSKPATAPDVFRQIGIRS 180 RVLWLDAHADFNTAQITPSGNIHGMPVACLCGMGPEELTTLGGSKPATAPDVFRQIGIRS Sbjct: 121 RVLWLDAHADFNTAQITPSGNIHGMPVACLCGMGPEELTTLGGSKPATAPDVFRQIGIRS 180 Query: 181 VDEGEKRLVREARVSIFDMRQIDESGMKRVMEEALEGVDADTHLHVSFDVDFLDPAIAPG 240 VDEGEKRLVREARVSIFDMRQIDESGMKRVMEEALEGVDADTHLHVSFDVDFLDPAIAPG Sbjct: 181 VDEGEKRLVREARVSIFDMRQIDESGMKRVMEEALEGVDADTHLHVSFDVDFLDPAIAPG 240 Query: 241 VGTTVRGGPNYREAQLCMEMIADTGRLASLDIVELNPAFDKRNQTAKLAVDLVESLFGKS 300 VGTTVRGGPNYREAQLCMEMIADTGRLASLDIVELNPAFDKRNQTAKLAVDLVESLFGKS Sbjct: 241 VGTTVRGGPNYREAQLCMEMIADTGRLASLDIVELNPAFDKRNQTAKLAVDLVESLFGKS 300 Query: 301 TLIR 304 TLIR Sbjct: 301 TLIR 304 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 304 Length adjustment: 27 Effective length of query: 277 Effective length of database: 277 Effective search space: 76729 Effective search space used: 76729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_0348 N515DRAFT_0348 (arginase)
to HMM TIGR01229 (rocF: arginase (EC 3.5.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01229.hmm # target sequence database: /tmp/gapView.29428.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01229 [M=300] Accession: TIGR01229 Description: rocF_arginase: arginase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-94 301.9 0.0 3e-94 301.7 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 N515DRAFT_0348 arginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 N515DRAFT_0348 arginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 301.7 0.0 3e-94 3e-94 1 299 [. 7 301 .. 7 302 .. 0.95 Alignments for each domain: == domain 1 score: 301.7 bits; conditional E-value: 3e-94 TIGR01229 1 sivglpfseGqgkrGvdkGpkalreaglleklkdlekevedlgqvaaaklekesdreavkaersvl 66 s++g+p + G+g+rG +Gp+alr a+l+++lk + +v d g+++ + e +re+ +++ +v+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 7 SLIGAPTDIGAGHRGASMGPEALRVANLQARLKARGIDVVDRGNLQGPLNPWEPPREGYRHLSAVV 72 589*******************************************666777888*********** PP TIGR01229 67 aakeklaekvkkvveekrfplvLggdHsiaiGtvsgvakkakdk..klgvlwlDAHaDintletst 130 ++++++e+++ + +r+p++LggdH +aiG++++va++ +++ kl vlwlDAHaD+nt++ ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 73 DWNRAVYEAIYGELSLGRLPVMLGGDHCLAIGSITAVARHCREHhkKLRVLWLDAHADFNTAQITP 138 ****************************************999777******************** PP TIGR01229 131 SgnlHGmPlafllgrlkkevedleelkllkgkeispkklvyiGlRdvdegErkilkelgikvfsmk 196 Sgn+HGmP+a l g +e ++l + k+ p iG+R+vdegE+++++e + +f+m+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 139 SGNIHGMPVACLCGMGPEELTTL---GGSKP-ATAPDVFRQIGIRSVDEGEKRLVREARVSIFDMR 200 **************444444444...45888.589******************************* PP TIGR01229 197 eidklGiakvvektleslkaedpihlSlDvDglDpklapatGtpvrgGltfrEgklilelllesgl 262 +id+ G+++v+e++le + a++ +h+S+DvD+lDp +ap++Gt+vrgG +rE++l +e+++++g+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 201 QIDESGMKRVMEEALEGVDADTHLHVSFDVDFLDPAIAPGVGTTVRGGPNYREAQLCMEMIADTGR 266 ****************************************************************** PP TIGR01229 263 ltaldlvEvNPtldikeksetikaavelvesllgetl 299 l +ld+vE+NP d ++++t+k av+lvesl+g++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0348 267 LASLDIVELNPAFD--KRNQTAKLAVDLVESLFGKST 301 **************..99****************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.83 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory