GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glt in Dyella japonica UNC79MFTsu3.2

Align Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter (characterized)
to candidate N515DRAFT_0019 N515DRAFT_0019 Na+/H+-dicarboxylate symporter

Query= SwissProt::O59010
         (425 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_0019 N515DRAFT_0019
           Na+/H+-dicarboxylate symporter
          Length = 438

 Score =  203 bits (516), Expect = 1e-56
 Identities = 147/437 (33%), Positives = 227/437 (51%), Gaps = 57/437 (13%)

Query: 12  VLQKILIGLILGAIVGLILGHY---------GYADAVKTYVKPFGDLFVRLLKMLVMPIV 62
           +LQ +LIG++  AI  L +G +          +A AV   + P G +F+RLL  +V+P+V
Sbjct: 11  ILQGLLIGVV-AAIATLAIGQFHPATLKTMQAFATAV---LDPLGQVFLRLLFFVVIPLV 66

Query: 63  FASLVVGAASISPARLGRVGVKIVVYYLLTSA---FAVTLGIIMARLFNPG--------- 110
           FASL  G A +   RLGR+G      + L +A    AV +G++M  L  PG         
Sbjct: 67  FASLASGVAQLG--RLGRLGPLAARTFALFAANMLIAVAIGLLMMNLLQPGHQLEPGSRE 124

Query: 111 -------AGIHLAVGGQQFQPKQAPPLVKILLDIVPTNPFGAL------ANGQVLPTIFF 157
                   G H A+  +Q QP  +  L   +   +P N  GA       A G VLP I F
Sbjct: 125 RLLQEYGGGAHRAMERRQQQPDMS--LATAVDMFMPRNLLGAFVGHDRGALGDVLPLILF 182

Query: 158 AIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVM 217
           AI++G A T L   +  K++   + L + + G       IV   ++ AP+ V A+I  V+
Sbjct: 183 AILVGAAATLLDEDKRLKLQSGLDLLSELMTG-------IVGFALRLAPVAVPAMIYSVI 235

Query: 218 AEQGVKVVGELAKVTAAVYVGLTLQILLVYFVLLKIYGI-DPISFIKKAKDAMLTAFVTR 276
            + G  V+  L+  TA   + L L +     + L++     P+++ ++ +  ++TAF T 
Sbjct: 236 VKIGTGVLLTLSVFTAGCALALALHLFGSLSLWLRLLARRSPLAYFRQIRPVLITAFSTS 295

Query: 277 SSSGTLPVTMRVAK-EMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTV 335
           SSS TLP ++ +A+ E+ +      F LPLGAT+NM GTAL++G    F+A A G  LT+
Sbjct: 296 SSSATLPASLALARDELRLRPSTAGFVLPLGATMNMSGTALFEGCVVLFVAQAFGVDLTL 355

Query: 336 GQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLESVGLPLTDPNVAAAYAMILGIDAILDM 395
           GQQ  ++L AVL+++  AG+PG    ++A +L + G+P           ++LG+D ILDM
Sbjct: 356 GQQCVLMLLAVLSAVAVAGIPGGSLPLIAGLLATFGVP------PEGIGLVLGVDRILDM 409

Query: 396 GRTMVNVTGDLTGTAIV 412
            RT VNV  DL    +V
Sbjct: 410 LRTTVNVGSDLVTATVV 426


Lambda     K      H
   0.325    0.141    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 436
Number of extensions: 24
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 425
Length of database: 438
Length adjustment: 32
Effective length of query: 393
Effective length of database: 406
Effective search space:   159558
Effective search space used:   159558
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory