Align Sodium:dicarboxylate symporter (characterized, see rationale)
to candidate N515DRAFT_1080 N515DRAFT_1080 Na+/H+-dicarboxylate symporter
Query= uniprot:A1S570 (437 letters) >FitnessBrowser__Dyella79:N515DRAFT_1080 Length = 422 Score = 265 bits (677), Expect = 2e-75 Identities = 144/397 (36%), Positives = 229/397 (57%), Gaps = 6/397 (1%) Query: 23 ILIGLLLRNFFGGSEWVQDYITEGFFHVIGTIFINSLKMLVVPLVFISLVCGTCSLSEPS 82 +L G +L G W+ + +F +G +++ +KM+ VPLVF ++V SL Sbjct: 16 VLAGFVLGALAG---WLCGPGSVAWFQPLGDVYVALIKMIAVPLVFFAVVNSVSSLHGVQ 72 Query: 83 KLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPG-NASLASESMQYSAKEAPSLADVLIN 141 ++ LGG+T ++ T A+A+ V + L PG + + Y +E PS VL++ Sbjct: 73 RMAALGGRTFLWFALTAALAVGVGLLVGHLTDPGLGVGQLTMAGDYKVREVPSAVKVLLD 132 Query: 142 IVPSNPMKALSEGNMLQIIIFAVIFGFAISHIGERGRRVAALFDDLNEVIMRVVTLIMQL 201 +VP+NP +ALSEG +LQ+I FA + G A+ IGE+ R+ LF + N+ +++V ++++ Sbjct: 133 VVPTNPFRALSEGKILQVIFFAGLLGLALVKIGEKSARLRELFGEANDAMIQVTRFVLEM 192 Query: 202 APYGVFALMGKLALTLGMETLESVIKYFMLVLVVLLFHGFVVYPTLLKLFSGLSPLMFIR 261 P G F L+ L G E L + K+ + + VVY LL L GLSP F R Sbjct: 193 TPIGTFGLIAALVAGYGFEKLLPLGKFVLALYAACAVQIVVVYGGLL-LAHGLSPRRFFR 251 Query: 262 KMRDVQLFAFSTASSNATLPVTMEASEHRLGADNKVASFTLPLGATINMDGT-AIMQGVA 320 + AF+++SS A++PV + + LG ASF +PLGA+I MDG AI ++ Sbjct: 252 GVLPAMQVAFTSSSSFASMPVALRSVTQNLGVSPAYASFAVPLGASIKMDGCGAIYPAIS 311 Query: 321 TVFIAQVFGIDLTITDYAMVVMTATLASIGTAGVPGVGLVMLAMVLNQVGLPVEGIALIL 380 ++F+AQ FG+ L Y ++++ + L S GTAGVPG VM+ +VL+ GLPVEGI ++ Sbjct: 312 SIFVAQYFGLQLEPAQYFVILLASVLGSFGTAGVPGTATVMVTLVLSSAGLPVEGIGYLV 371 Query: 381 GVDRMLDMVRTAVNVTGDTVATVVIAKSEGALNEAVF 417 +DR+LDM+RT NVTG + V++A+ +G L+ V+ Sbjct: 372 AIDRVLDMMRTMTNVTGQMLVPVLVAREQGLLDMDVY 408 Lambda K H 0.325 0.139 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 422 Length adjustment: 32 Effective length of query: 405 Effective length of database: 390 Effective search space: 157950 Effective search space used: 157950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory