Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 115 bits (289), Expect = 1e-30 Identities = 80/239 (33%), Positives = 132/239 (55%), Gaps = 20/239 (8%) Query: 25 FYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQKPTSGEVVYDGYNIWKNKRKIF 84 F AL D SL + +G+ + +LG SG+GK++L R++ GL P G+V+ DG ++ Sbjct: 15 FAALDDFSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVLRDGTDLLA-----L 69 Query: 85 KKYRKDVQLIPQDPYSTLPFNKTVEEIL----VAPILRWEKINKDELRKRLINLLELVKL 140 R+D+ L+ Q Y+ P + I V P R + ++ ++ R+ +LL V+L Sbjct: 70 PAQRRDIGLVFQH-YALFPHMTVADNIAFGLRVRP--RARRPSRRDIAARVEDLLRRVQL 126 Query: 141 TPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLRIGILNTLAEIK 200 EE +YP QLSGGQ+QR+++AR+L+V P +++ DEP +DA +R + L +++ Sbjct: 127 ---EELGRRYPTQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLRVWLRDLQ 183 Query: 201 NRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERADLEEILKDPLHPYTNDLI 259 L LT V +THD A L D+ +VM GRI + EI ++P P+ + + Sbjct: 184 RSLGLTTVLVTHDQDEA---LELADR--VVVMNRGRIEQVGAPSEIYREPATPFVHGFV 237 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 384 Length adjustment: 29 Effective length of query: 295 Effective length of database: 355 Effective search space: 104725 Effective search space used: 104725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory