Align CBP protein aka CebF, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate N515DRAFT_3134 N515DRAFT_3134 multiple sugar transport system permease protein
Query= TCDB::Q9X9R6 (306 letters) >FitnessBrowser__Dyella79:N515DRAFT_3134 Length = 292 Score = 176 bits (446), Expect = 6e-49 Identities = 103/286 (36%), Positives = 160/286 (55%), Gaps = 9/286 (3%) Query: 20 YAFVAPFFLLFGAFSLVPLLYTAWYSLHNVQLSALDH---KTWAGLDNYENLLSSDFFWN 76 + F+AP L+ G F L+P++ SL + L AL + L NY LL FW+ Sbjct: 8 WLFLAPALLVLGLFFLLPVIAALALSLTDYDLYALADIRDLRFVALGNYWELLHRPLFWS 67 Query: 77 ALKNTLTIGIISTVPQLLAALALAHLLNYKL-RGSTAWRVVMLTPYATSVAAATLVFTLL 135 AL +TL ++ ++A+L A LLN L R +R + P T+V A +++ L Sbjct: 68 ALGHTLYFVLVGVPLSIVASLGAALLLNSPLARCKPLFRTALFAPVVTTVVAVAVIWRYL 127 Query: 136 YSWDGGMVNWILDFFGVDPVNWRESDWGSQFAVSSIVIWRWTGYNALIYLAAMQAIPADL 195 ++ G+ N+ L G+ PV+W + + +W+ GYN +I+LAA+QAIPADL Sbjct: 128 FNTKYGLANYALGGLGIHPVDWLGDPRWAMPTIILFAVWKNFGYNMIIFLAALQAIPADL 187 Query: 196 YESAALDGANRWQQFRHVTVPQLRPTILFTVVVSTIGATQLFGEPLLFGGVSGSKGGSEH 255 YE+A +DGA+ +QFRH+T+P L PT+L +++ G QLF EP + ++GG Sbjct: 188 YEAARIDGASPLRQFRHITLPMLGPTLLMVGILTVSGYFQLFAEPFVM-----TEGGPLQ 242 Query: 256 QYQTLGLYMYDQGWIIGNLGKASAIAWSMFLILLIVAAVNLLLTRR 301 ++ MY++G+ NLG ASA+A+ +FLI+ V AV L + RR Sbjct: 243 STTSVLYLMYEEGFKWWNLGSASAVAFLLFLIMFAVTAVMLRVARR 288 Lambda K H 0.324 0.137 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 292 Length adjustment: 27 Effective length of query: 279 Effective length of database: 265 Effective search space: 73935 Effective search space used: 73935 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory