Align CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate N515DRAFT_3133 N515DRAFT_3133 carbohydrate ABC transporter membrane protein 2, CUT1 family (TC 3.A.1.1.-)
Query= TCDB::Q9X9R5 (276 letters) >FitnessBrowser__Dyella79:N515DRAFT_3133 Length = 273 Score = 184 bits (466), Expect = 2e-51 Identities = 96/256 (37%), Positives = 155/256 (60%), Gaps = 2/256 (0%) Query: 22 LVSLAPLVWTAIAASRTNHRLAETPPPLWFGGNLFKNLEAAWEQAGLGTAMLNSVIVAGT 81 LV++ PL+W + + PPPL N +E+AG+G +LNS+ V+ Sbjct: 19 LVAVFPLLWMLSVSFMRPGEASALPPPLLPTHATLANYHELFERAGMGRYLLNSLGVSSA 78 Query: 82 ITVSTVLFSTLAGFAFAKLRFRFSGLLLLLTIGTMMIPPQLAVVPLYLWMSDLGWSNQLH 141 IT+ ++ F+ +AG+AFAKLRF L + +G ++IP Q+A++PL+L + LG N Sbjct: 79 ITLLSLAFNLMAGYAFAKLRFSGRERLFQVLLGGLVIPAQVAMLPLFLLLKYLGLVNSYA 138 Query: 142 TVILPSLVTAFGTFFMRQYLVQALPTELIEAARVDGASSLRIVWHVVFPAARPAMAVLGL 201 V++P++ T FG F +RQY + +P +L+EAAR+DGA LRI +V P +P M L + Sbjct: 139 AVVVPAMATIFGIFLVRQY-ARGIPDDLMEAARIDGAGELRIFVQIVLPLLKPIMVTLAI 197 Query: 202 LTFVFAWNDFLWPIIAL-NQQNPTVQVGPELARHRVLPDQAVIMAGALLGTLPLLVAFLL 260 TF+ AWNDF+WP+IAL Q++ T+ + + D ++MAG+++ LP+LV FL Sbjct: 198 FTFLTAWNDFMWPLIALTGQEHYTLPIALASLSREHVQDSELMMAGSVVTVLPVLVLFLA 257 Query: 261 FGKQIVGGIMQGAIKG 276 + + G++ G++KG Sbjct: 258 LQRYYLQGLLLGSVKG 273 Lambda K H 0.327 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 273 Length adjustment: 25 Effective length of query: 251 Effective length of database: 248 Effective search space: 62248 Effective search space used: 62248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory