Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate N515DRAFT_0393 N515DRAFT_0393 glucokinase
Query= curated2:Q2W5F9 (321 letters) >FitnessBrowser__Dyella79:N515DRAFT_0393 Length = 333 Score = 211 bits (538), Expect = 2e-59 Identities = 128/317 (40%), Positives = 180/317 (56%), Gaps = 8/317 (2%) Query: 3 QMVLVADIGGTHARFALMGPDGEAVNPVVLRC-----ADYDGPAPAIKAYLAEHAGGVAP 57 ++VL AD+GGTHAR L+ A VL AD+ G A + +LA H G Sbjct: 14 KLVLAADVGGTHARIGLVDAAAPAGASGVLAYERYAGADWPGLAEILADFLARHPGHAVD 73 Query: 58 KGGAFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHL 117 + A AVA + + N W +AE R+ + L+RL+VVNDF A+A + ++L + Sbjct: 74 EA-AIAVAGYVRDGELVAENLRWPVRLAELRERLRLRRLQVVNDFEALAFATQYLGADDS 132 Query: 118 MSVGGGMPEAGLPIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILD 177 ++V AG P+AV+GPGTGLG + L+P +G T L +EGGHV +A +ERE +L Sbjct: 133 LAVIDAPAAAG-PVAVVGPGTGLGCALLVPDGNGV-TVLPSEGGHVALAPGSEREMALLQ 190 Query: 178 RLRTQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVE 237 L D+V VLSG GLVNLY+A+ L G AV + P+ I+ LDG ++ + + Sbjct: 191 LLSRGRDYVHTGHVLSGPGLVNLYRAIGELDGLSAVHAQPEQISAAALDGGDALALDTLH 250 Query: 238 VFFAMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIP 297 F AM+G G+LA+ A GGVF+AGGILP++ E S+FR RF G + +LA +P Sbjct: 251 TFCAMLGGFVGDLAVLFKASGGVFLAGGILPQLREFLPYSAFRERFFNKGVMRDFLAGVP 310 Query: 298 TWLITHPLPAFVGLAGL 314 LI H +G AGL Sbjct: 311 VRLIEHGRLGVLGAAGL 327 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 333 Length adjustment: 28 Effective length of query: 293 Effective length of database: 305 Effective search space: 89365 Effective search space used: 89365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_0393 N515DRAFT_0393 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.1989057.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-74 236.7 0.1 2.3e-74 236.4 0.1 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 N515DRAFT_0393 glucokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 N515DRAFT_0393 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 236.4 0.1 2.3e-74 2.3e-74 1 315 [] 17 325 .. 17 325 .. 0.94 Alignments for each domain: == domain 1 score: 236.4 bits; conditional E-value: 2.3e-74 TIGR00749 1 lvgdiGGtnarlalvev.apgeieqv...ktyssedfpsleavvrvyleeakvelkdpikgcfaia 62 l++d+GGt+ar++lv+ ap ++ v + y + d+p l +++ +l ++ + d ++++a+a lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 17 LAADVGGTHARIGLVDAaAPAGASGVlayERYAGADWPGLAEILADFLARHPGHAVD--EAAIAVA 80 79*************7516788888888899*******************9887777..7****** PP TIGR00749 63 tPiigdfvrltnldWalsieelkqelalaklelindfaavayailalkeed.liqlggakveesaa 127 + + + nl W + +el++ l l++l+++ndf a a+a + l+ +d l+++++ + +++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 81 GYVRDGELVAENLRWPVRLAELRERLRLRRLQVVNDFEALAFATQYLGADDsLAVIDA--PAAAGP 144 *******99**************************************98873666665..45789* PP TIGR00749 128 iailGaGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsG 193 +a++G+GtGlG a l+++++g vl++eGghv +aP se e+ ll++l + + v vlsG+G lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 145 VAVVGPGTGLGCALLVPDGNG-VTVLPSEGGHVALAPGSEREMALLQLLSRGRDYVHTGHVLSGPG 209 *****************8887.689***************************************** PP TIGR00749 194 lvliyealskrkgerevsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklga 259 lv++y+a+ + + ls + ++++is aal+g d+la +l++f+++lG + g+la+ + a lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 210 LVNLYRAIGELD------GLSAVHAQPEQISAAALDGGDALALDTLHTFCAMLGGFVGDLAVLFKA 269 ********9888......567777999*************************************** PP TIGR00749 260 rGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 GGv++aGGi+P++ e+l s+fr++f +kG ++++la +Pv+++ + + G+lGa+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0393 270 SGGVFLAGGILPQLREFLPYSAFRERFFNKGVMRDFLAGVPVRLIEHGRLGVLGAA 325 ******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 16.99 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory