GapMind for catabolism of small carbon sources

 

Alignments for a candidate for glk in Dyella japonica UNC79MFTsu3.2

Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate N515DRAFT_4210 N515DRAFT_4210 glucokinase

Query= curated2:B4SRZ6
         (335 letters)



>FitnessBrowser__Dyella79:N515DRAFT_4210
          Length = 339

 Score =  326 bits (835), Expect = 6e-94
 Identities = 170/326 (52%), Positives = 219/326 (67%), Gaps = 6/326 (1%)

Query: 2   SASSQPVLVADIGGTNARFALADTSLDAPLQQDSIREYAVAEFPSLGDAARHHLEQIGAT 61
           S SS   L+AD+GGTN RFALAD +L  PL  DS+R Y V +FPS+ D  R +    G +
Sbjct: 3   STSSAKTLLADLGGTNVRFALADPALPQPLLLDSVRRYRVKDFPSMADTIRQYFADSGLS 62

Query: 62  ASRGVFAVAGR-VDGDEARITNHPWVISRSRTAAMLGFDELHLINDFAAQAMAISLLQSD 120
           A R V A AGR VDG+  ++TN+PW +S    AA L FD + LINDFAAQ MA+ LL  +
Sbjct: 63  AGRAVIAAAGRIVDGETVKVTNNPWQVSAHGLAADLKFDSVRLINDFAAQGMAVPLLACN 122

Query: 121 DVVQVGGAAWVPGKPG--QPRNYAVIGPGTGLGVGGLILRHGRCYPLETEGGHVSFPPGT 178
           ++  VG     P K G    + + V+GPGTGLGV GL+LR GR   LETEGGH  F   T
Sbjct: 123 ELQPVGAPQ--PPKIGAHHSQTFVVVGPGTGLGVAGLLLRDGRWTVLETEGGHAGFAAHT 180

Query: 179 PEEIRILEILSEQFGRVSNERLICGPGLVNIHRAVCEMAGIDPGQLQPVDVTARALHG-D 237
            E++ IL  L+ +FGRVSNER+ICG GLVN++ A+ ++ G+   +  P D+T RA  G D
Sbjct: 181 AEDVEILHRLNARFGRVSNERMICGNGLVNLYLALADIEGLKAEEYTPEDITTRANAGTD 240

Query: 238 PQAMRTVDVFCAVFGAIAGDLVLTQGAWDGVFLTGGLTPKMLDSLQHSGFRQRFEHKGRF 297
           P  +RTV+    +FG++AGDLVL+ G WDGVFLTGG+ P +L  LQH GFR+RFE KGRF
Sbjct: 241 PLCVRTVETLAGIFGSVAGDLVLSLGGWDGVFLTGGVLPILLPWLQHGGFRERFESKGRF 300

Query: 298 SSIMARVPSLAVMHPHAGLLGAAAYA 323
              M +VP++A+MH   GLLGAAA+A
Sbjct: 301 KETMEQVPTVAMMHAETGLLGAAAFA 326


Lambda     K      H
   0.321    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 323
Number of extensions: 15
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 335
Length of database: 339
Length adjustment: 28
Effective length of query: 307
Effective length of database: 311
Effective search space:    95477
Effective search space used:    95477
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate N515DRAFT_4210 N515DRAFT_4210 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.1739.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.1739.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.