Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate N515DRAFT_3134 N515DRAFT_3134 multiple sugar transport system permease protein
Query= uniprot:A3DHA3 (284 letters) >FitnessBrowser__Dyella79:N515DRAFT_3134 Length = 292 Score = 144 bits (363), Expect = 2e-39 Identities = 89/287 (31%), Positives = 149/287 (51%), Gaps = 11/287 (3%) Query: 8 AGYLFSSPYLAGFLIFFAIPSAMSVYYCFT-------RGVGSFEFAGLDNFKSVIASNSY 60 A +LF +P L +FF +P ++ T + F L N+ ++ + Sbjct: 6 AAWLFLAPALLVLGLFFLLPVIAALALSLTDYDLYALADIRDLRFVALGNYWELLHRPLF 65 Query: 61 RLAVKNTLIFNSVSVPVIMIVSLLLAMLLNKALRGAR-YFRMFFVLPLVIPVASIILVWQ 119 A+ +TL F V VP+ ++ SL A+LLN L + FR P+V V ++ ++W+ Sbjct: 66 WSALGHTLYFVLVGVPLSIVASLGAALLLNSPLARCKPLFRTALFAPVVTTVVAVAVIWR 125 Query: 120 ITFN-EFGVLNNLLNHFGIAGVEWLNS-KWSIAVLVLLYVWKNCGYNIILFTAGLNSIPK 177 FN ++G+ N L GI V+WL +W++ ++L VWKN GYN+I+F A L +IP Sbjct: 126 YLFNTKYGLANYALGGLGIHPVDWLGDPRWAMPTIILFAVWKNFGYNMIIFLAALQAIPA 185 Query: 178 DYYDAASIDGAGGFKCFTSITLPLLVPTIFFVFIISIINSFKVFREAYLLCGNYPPLNMY 237 D Y+AA IDGA + F ITLP+L PT+ V I+++ F++F E +++ P + Sbjct: 186 DLYEAARIDGASPLRQFRHITLPMLGPTLLMVGILTVSGYFQLFAEPFVMTEGGPLQSTT 245 Query: 238 MLQHFM-NNNFNNLNYQRLSTASLLMELFIVAIVFLMYKIEGRYGKS 283 + + M F N S + L+ L + A+ +M ++ R G++ Sbjct: 246 SVLYLMYEEGFKWWNLGSASAVAFLLFLIMFAVTAVMLRVARRGGEA 292 Lambda K H 0.331 0.144 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 292 Length adjustment: 26 Effective length of query: 258 Effective length of database: 266 Effective search space: 68628 Effective search space used: 68628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory