Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate N515DRAFT_3133 N515DRAFT_3133 carbohydrate ABC transporter membrane protein 2, CUT1 family (TC 3.A.1.1.-)
Query= uniprot:A3DHA2 (303 letters) >FitnessBrowser__Dyella79:N515DRAFT_3133 Length = 273 Score = 160 bits (404), Expect = 4e-44 Identities = 95/278 (34%), Positives = 160/278 (57%), Gaps = 21/278 (7%) Query: 29 ILIVITVVLLFPILFTIANSFMSDKEVLDTYQKKIEEVEEGESTEFLGFKLIPDMVSMKQ 88 +LI T+V +FP+L+ ++ SFM GE++ L L+P ++ Sbjct: 13 LLIGSTLVAVFPLLWMLSVSFM----------------RPGEASA-LPPPLLPTHATLAN 55 Query: 89 YYTVLFRKPTFLLMFLNSAIMTIPIVIIQVIVGVFAAYAFAKLRFPLRDKLFFVFIVVML 148 Y+ LF + LNS ++ I ++ + + A YAFAKLRF R++LF V + ++ Sbjct: 56 YHE-LFERAGMGRYLLNSLGVSSAITLLSLAFNLMAGYAFAKLRFSGRERLFQVLLGGLV 114 Query: 149 MPLQVTLVPNYILLRKLDMIGSFLSVILPGGFSAFGVVLLRQYMRGIPDECCEAAMIDGA 208 +P QV ++P ++LL+ L ++ S+ +V++P + FG+ L+RQY RGIPD+ EAA IDGA Sbjct: 115 IPAQVAMLPLFLLLKYLGLVNSYAAVVVPAMATIFGIFLVRQYARGIPDDLMEAARIDGA 174 Query: 209 GYLKTFTKIILPQCKSIIASLAILAFIDNWNMVEQPLIFLSDSAKYPLSVYLAYINE--- 265 G L+ F +I+LP K I+ +LAI F+ WN PLI L+ Y L + LA ++ Sbjct: 175 GELRIFVQIVLPLLKPIMVTLAIFTFLTAWNDFMWPLIALTGQEHYTLPIALASLSREHV 234 Query: 266 GDLGLAFASGVLYMIPTVLIYLYGEKYFVEGIQLTGIK 303 D L A V+ ++P ++++L ++Y+++G+ L +K Sbjct: 235 QDSELMMAGSVVTVLPVLVLFLALQRYYLQGLLLGSVK 272 Lambda K H 0.331 0.147 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 273 Length adjustment: 26 Effective length of query: 277 Effective length of database: 247 Effective search space: 68419 Effective search space used: 68419 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory