Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= TCDB::P96483 (377 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 203 bits (517), Expect = 6e-57 Identities = 139/369 (37%), Positives = 195/369 (52%), Gaps = 34/369 (9%) Query: 20 AVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKDRDI 79 A+D + I +GEF+ L+GPSG GKS+ LR+LAGL+D + G + D+ LP + RDI Sbjct: 17 ALDDFSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVLRDGTDLLALPAQRRDI 76 Query: 80 AMVFQNYALYPHMTVADNMGFALKIAGVPKA------EIRQKVEEAAKILDLTQYLDRKP 133 +VFQ+YAL+PHMTVADN+ F L++ P+A +I +VE+ + + L + R P Sbjct: 77 GLVFQHYALFPHMTVADNIAFGLRVR--PRARRPSRRDIAARVEDLLRRVQLEELGRRYP 134 Query: 134 KALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVT 193 LSGGQRQRVA+ RA+ EP + L+DEP LDA++R + R + LQR LG+TTV VT Sbjct: 135 TQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLRVWLRDLQRSLGLTTVLVT 194 Query: 194 HDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPAMNLVEVPITDGGV 253 HDQ EA+ + DRV V+ G ++QV +P +Y +PA FV GF+G N + + + Sbjct: 195 HDQDEALELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGFVG--RANRIRGHVERDRL 252 Query: 254 KFGNSVVPVNREALSAADKGDRTVTVGVRPEHFDVVE--LGGAVAASLSKDSADAPAGLA 311 G + + D R + +RPEH + LGG D A A Sbjct: 253 HLGGH----SFQGELPGDLAGREIEAWLRPEHLALASRGLGGWTGRLQHLDLAGPVARAR 308 Query: 312 VSVNVVEELGADGYV----YGTAEVG------GEVKDLVVR--VNGRQVPEKGSTLHVVP 359 ++++ DG V + AEV GEV L R VP L VP Sbjct: 309 LAMH------GDGLVLDAEWNAAEVAAHGLAIGEVVTLQPREFTLFADVPGGVRRLRFVP 362 Query: 360 RPGETHVFS 368 P H S Sbjct: 363 APAGPHADS 371 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 384 Length adjustment: 30 Effective length of query: 347 Effective length of database: 354 Effective search space: 122838 Effective search space used: 122838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory