Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate N515DRAFT_2043 N515DRAFT_2043 putative ABC transport system ATP-binding protein
Query= TCDB::P96483 (377 letters) >FitnessBrowser__Dyella79:N515DRAFT_2043 Length = 230 Score = 114 bits (285), Expect = 3e-30 Identities = 67/199 (33%), Positives = 107/199 (53%), Gaps = 6/199 (3%) Query: 24 LDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPP------KDR 77 +++ I +G+FL L+GPSG GK+T L ++ GL+ GG+I +G + + L + Sbjct: 29 INLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSPTGGSIGVGGQRIDQLGAGALAKWRAA 88 Query: 78 DIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKPKALS 137 ++ VFQ Y L P +T N+ L + + A+ R+ A +++ L + KP LS Sbjct: 89 NVGFVFQFYNLMPMLTAQRNVELPLLLTKLSAAQRRKNAAIALQLVGLDERSSHKPSELS 148 Query: 138 GGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQV 197 GGQ+QRVA+ RAIV +P + + DEP +LD + + +L R G T V VTHD Sbjct: 149 GGQQQRVAIARAIVSDPTLLVCDEPTGDLDRQSAEDVLGLLRTLNREHGKTIVMVTHDPK 208 Query: 198 EAMTMGDRVAVLKDGLLQQ 216 A + + K L++Q Sbjct: 209 AAEYANHTLHLDKGTLVEQ 227 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 230 Length adjustment: 26 Effective length of query: 351 Effective length of database: 204 Effective search space: 71604 Effective search space used: 71604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory