Align Citrate:H+ symporter (characterized)
to candidate N515DRAFT_0011 N515DRAFT_0011 MFS transporter, MHS family, alpha-ketoglutarate permease
Query= TCDB::P16482 (444 letters) >FitnessBrowser__Dyella79:N515DRAFT_0011 Length = 435 Score = 224 bits (571), Expect = 4e-63 Identities = 127/380 (33%), Positives = 199/380 (52%), Gaps = 4/380 (1%) Query: 17 RMMATAGGARIGAILRVTSGNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFAVFG 76 R A G R+ +I + GN +E +D++++ ++ Y A FFPAS + L+ T +F Sbjct: 11 RAPAMTAGQRLRSIFSGSIGNLVEWYDWYVYSAFSLYFAQVFFPASDQTTQLLNTSGIFA 70 Query: 77 AGFLMRPIGAIVLGAYIDKVGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIG 136 GFLMRP+G +LG + D+ GR+ L++++ +M+ G+ +I L P Y IG+ AP+L+++ Sbjct: 71 VGFLMRPLGGWLLGTFADRRGRKAALLLSVFMMSLGSLIIGLSPGYAQIGVAAPILLVLA 130 Query: 137 RLLQGFSAGAELGGVSVYLAEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFAL-NAVLEP 195 RLLQG S G E G + YL+E+A +GF++S Q + ++A A+ L + VL Sbjct: 131 RLLQGLSIGGEYGTSATYLSEMAPRESRGFWSSIQYVTLVAGQLIALALLVVLQHFVLST 190 Query: 196 SAISDWGWRIPFLFGVLIVPFIFILRRKLEETQEFTARRHHLAMRQVFATLLANWQVVIA 255 + DWGWRIPFL G L+ I+RR ++ET F R + TL+ + + V+ Sbjct: 191 QQLHDWGWRIPFLIGALLAVIAVIIRRNMDETASFKKARQ---LESPLRTLMRHPREVLT 247 Query: 256 GMMMVAMTTTAFYLITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDRFG 315 + + T AFY T Y F +S +D+ ++ P GALSDR G Sbjct: 248 VIGLTMGGTLAFYTFTTYMQKFLVNSAGMSKADATSISTAALFVYALLQPAFGALSDRIG 307 Query: 316 RRSVLIAMTLLALATAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMIPALTEIMPA 375 RR +LI +L +P L+ L A + +++ I Y E+ P Sbjct: 308 RRPLLIGFGVLGALLTYPILSTLKEAHDWWQAFGLIMAALIIVSGYTSINAVVKAELFPT 367 Query: 376 EVRVAGFSLAYSLATAVFGG 395 E+R G L Y+LA +VFGG Sbjct: 368 EIRAIGVGLPYALALSVFGG 387 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 435 Length adjustment: 32 Effective length of query: 412 Effective length of database: 403 Effective search space: 166036 Effective search space used: 166036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory