Align Citrate lyase subunit beta; Citrase beta chain; Citrate (pro-3S)-lyase subunit beta; Citryl-CoA lyase subunit; EC 4.1.3.6; EC 4.1.3.34 (characterized)
to candidate N515DRAFT_2434 N515DRAFT_2434 (S)-citramalyl-CoA lyase
Query= SwissProt::P0A9I1 (302 letters) >FitnessBrowser__Dyella79:N515DRAFT_2434 Length = 321 Score = 120 bits (300), Expect = 5e-32 Identities = 88/283 (31%), Positives = 135/283 (47%), Gaps = 17/283 (6%) Query: 11 TRTRRSMLFVPGANAAMVSNSFIYPADALMFDLEDSVALREKDTARRMVYHALQHPLYRD 70 +R RS+LF P A N+ AD + DLEDSVA K AR P Sbjct: 31 SRYCRSILFTPALVAERSVNADAADADIALIDLEDSVAAVHKAEARNRAVAFFSRPPITS 90 Query: 71 IETIVRVNALDSEWGVNDLEAVVRGG--ADVVRLPKTDTAQDVLDIEKEILRIEKACGRE 128 VR+N L S G+ DL A+ +VV +PK ++ +D L+I +L Sbjct: 91 CRRAVRINNLGSADGLLDLLALCGCPYKPEVVMVPKVESPRD-LEIAGSLLG-------- 141 Query: 129 PGSTGLLAAIESPLGITRAVEIAHASERLIGIALGAEDYVRNLRTERSPEGTELLFARCS 188 L+A IE+PLGI RL GA D+ L T S + +AR Sbjct: 142 -DGVELIAIIETPLGIENISATVSTRARLTATIFGAADFA--LTTGMSIDWQSQHYARSR 198 Query: 189 ILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIKQLGFDGKSLINPRQIDLLHNLYAPTQ 248 + A R AG+ D+ + D + G A ++LG+ G ++P Q+ +++ +++P+Q Sbjct: 199 LATATRGAGLHPLDSPWFDVRDAEGLTIAARRARELGYSGMGAVHPCQVPIINEIFSPSQ 258 Query: 249 KEVDHARRVVEAAEAAAREGLGVVSLNGKMVDGPVIDRARLVL 291 ++D ARR+V A+AR+G G+ ++G V P I+ AR +L Sbjct: 259 DDIDRARRLV---AASARDGSGICLIDGIAVGAPFIESARRLL 298 Lambda K H 0.318 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 321 Length adjustment: 27 Effective length of query: 275 Effective length of database: 294 Effective search space: 80850 Effective search space used: 80850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory