Align Citrate lyase subunit beta; Citrase beta chain; Citrate (pro-3S)-lyase subunit beta; Citryl-CoA lyase subunit; EC 4.1.3.6; EC 4.1.3.34 (characterized)
to candidate N515DRAFT_3215 N515DRAFT_3215 citrate lyase subunit beta / citryl-CoA lyase
Query= SwissProt::P0A9I1 (302 letters) >FitnessBrowser__Dyella79:N515DRAFT_3215 Length = 284 Score = 160 bits (404), Expect = 4e-44 Identities = 106/284 (37%), Positives = 152/284 (53%), Gaps = 8/284 (2%) Query: 15 RSMLFVPGANAAMVSNSFIYPADALMFDLEDSVALREKDTARRMVYHALQHPLYRDIET- 73 RS LFVPG + + + ADAL FDLEDSV K AR + L R Sbjct: 2 RSKLFVPGGRPELFAKALAGEADALSFDLEDSVTPELKGAARTAIASFLATEAARQSPKL 61 Query: 74 -IVRVNALDSEWGVNDLEAVVRGGADVVRLPKTDTAQDVLDIEKEILRIEKACGREPGST 132 IVR NA + + +D+EAVV G ++ LPK ++A++V I R+E G + T Sbjct: 62 MIVRTNAPSTPYFADDIEAVVGDGVTLINLPKIESAEEVRAAVDMIARVEATRGWQR-RT 120 Query: 133 GLLAAIESPLGITRAVEIAHASERLIGIALGAEDYVRNLRTERSPEGT--ELLFARCSIL 190 LL IE+PL + RA IA A R+ G+ LG D ER +LFA + Sbjct: 121 RLLVNIETPLALARAASIAGAHPRVAGLQLGLADMFEPYGIERRDLANVHSVLFA---MR 177 Query: 191 QAARSAGIQAFDTVYSDANNEAGFLQEAAHIKQLGFDGKSLINPRQIDLLHNLYAPTQKE 250 AA A + A D ++D + G+ +EAA ++LG+ GKS I+PRQ+ L + +A + E Sbjct: 178 MAAAQADVFALDGAFADVADSEGYREEAALARRLGYLGKSCIHPRQVALANQAFAVSDAE 237 Query: 251 VDHARRVVEAAEAAAREGLGVVSLNGKMVDGPVIDRARLVLSRA 294 ++ ARR+VEAA +G G ++GKMVD P + RA+ +L+ A Sbjct: 238 IESARRIVEAAREPGNQGRGAFMVDGKMVDLPFLKRAQALLAAA 281 Lambda K H 0.318 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 284 Length adjustment: 26 Effective length of query: 276 Effective length of database: 258 Effective search space: 71208 Effective search space used: 71208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory